Search Antibody, Protein, and ELISA Kit Solutions

CSEN Antibody - N-terminal region (ARP31932_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP31932_P050-FITC Conjugated

ARP31932_P050-HRP Conjugated

ARP31932_P050-Biotin Conjugated

Tested Species Reactivity:
Human, Mouse
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-111016 from Santa Cruz Biotechnology.
The immunogen is a synthetic peptide directed towards the N terminal region of human CSEN
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Complete computational species homology data:
Anti-CSEN (ARP31932_P050)
Peptide Sequence:
Synthetic peptide located within the following region: STVRHQPEGLDQLQAQTKFTKKELQSLYRGFKNECPTGLVDEDTFKLIYA
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-KCNIP3 (ARP31932_P050) antibody is Catalog # AAP31932 (Previous Catalog # AAPP02829)
Printable datasheet for anti-KCNIP3 (ARP31932_P050) antibody
Target Reference:
Zaidi,N.F., et al., (2004) J. Neurochem. 89 (3), 593-601

Fernandes, V. S. et al. Endogenous hydrogen sulfide has a powerful role in inhibitory neurotransmission to the pig bladder neck. J. Urol. 189, 1567-73 (2013). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 23063804

Gene Symbol:
Official Gene Full Name:
Kv channel interacting protein 3, calsenilin
Alias Symbols:
NCBI Gene Id:
Protein Name:
Description of Target:
CSEN is a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belong to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. The protein encoded by this gene is also shown to function as a calcium-regulated transcriptional repressor, and to interact with presenilins. Mutations in the presenilin genes have been implicated in Alzheimer's disease.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Size (# AA):
Molecular Weight:
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CSEN.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CSEN.
Protein Interactions:

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...