Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP31932_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP31932_P050-FITC Conjugated

ARP31932_P050-HRP Conjugated

ARP31932_P050-Biotin Conjugated

CSEN Antibody - N-terminal region (ARP31932_P050)

Catalog#: ARP31932_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human, Mouse
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-111016 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human CSEN
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Complete computational species homology data Anti-CSEN (ARP31932_P050)
Peptide Sequence Synthetic peptide located within the following region: STVRHQPEGLDQLQAQTKFTKKELQSLYRGFKNECPTGLVDEDTFKLIYA
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-KCNIP3 (ARP31932_P050) antibody is Catalog # AAP31932 (Previous Catalog # AAPP02829)
Datasheets/Manuals Printable datasheet for anti-KCNIP3 (ARP31932_P050) antibody
Target Reference Zaidi,N.F., et al., (2004) J. Neurochem. 89 (3), 593-601
Publications

Fernandes, V. S. et al. Endogenous hydrogen sulfide has a powerful role in inhibitory neurotransmission to the pig bladder neck. J. Urol. 189, 1567-73 (2013). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 23063804

Gene Symbol KCNIP3
Official Gene Full Name Kv channel interacting protein 3, calsenilin
Alias Symbols CSEN, DREAM, KCHIP3
NCBI Gene Id 30818
Protein Name Calsenilin
Description of Target CSEN is a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belong to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. The protein encoded by this gene is also shown to function as a calcium-regulated transcriptional repressor, and to interact with presenilins. Mutations in the presenilin genes have been implicated in Alzheimer's disease.
Swissprot Id Q9Y2W7
Protein Accession # NP_038462
Nucleotide Accession # NM_013434
Protein Size (# AA) 256
Molecular Weight 29kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express CSEN.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express CSEN.
Protein Interactions MAVS; CD177; IGLV3-25; IL6ST; IGF1R; KCND2; CLN3; CALM2; KCNIP3; PPP3CA; GRK6; ADRBK1; UBE2I; UBC; PCBD2; TARBP2; PSEN2; CASP3; CREM; CREB1; PSEN1; CRK;
  1. What is the species homology for "CSEN Antibody - N-terminal region (ARP31932_P050)"?

    The tested species reactivity for this item is "Human, Mouse". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish".

  2. How long will it take to receive "CSEN Antibody - N-terminal region (ARP31932_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CSEN Antibody - N-terminal region (ARP31932_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CSEN Antibody - N-terminal region (ARP31932_P050)"?

    This target may also be called "CSEN, DREAM, KCHIP3" in publications.

  5. What is the shipping cost for "CSEN Antibody - N-terminal region (ARP31932_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CSEN Antibody - N-terminal region (ARP31932_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CSEN Antibody - N-terminal region (ARP31932_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "29kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CSEN Antibody - N-terminal region (ARP31932_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "KCNIP3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "KCNIP3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "KCNIP3"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "KCNIP3"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "KCNIP3"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "KCNIP3"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CSEN Antibody - N-terminal region (ARP31932_P050)
Your Rating
We found other products you might like!