Catalog No: ARP31932_P050
Price: $0.00
SKU
ARP31932_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-KCNIP3 (ARP31932_P050) antibody
Product Info
Tested Species ReactivityHuman, Mouse
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human CSEN
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Peptide SequenceSynthetic peptide located within the following region: STVRHQPEGLDQLQAQTKFTKKELQSLYRGFKNECPTGLVDEDTFKLIYA
Concentration0.5 mg/ml
Blocking PeptideFor anti-KCNIP3 (ARP31932_P050) antibody is Catalog # AAP31932 (Previous Catalog # AAPP02829)
ReferenceZaidi,N.F., et al., (2004) J. Neurochem. 89 (3), 593-601
Publications

Fernandes, V. S. et al. Endogenous hydrogen sulfide has a powerful role in inhibitory neurotransmission to the pig bladder neck. J. Urol. 189, 1567-73 (2013). 23063804

Gene SymbolKCNIP3
Gene Full NameKv channel interacting protein 3, calsenilin
Alias SymbolsCSEN, DREAM, KCHIP3
NCBI Gene Id30818
Protein NameCalsenilin
Description of TargetCSEN is a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belong to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. The protein encoded by this gene is also shown to function as a calcium-regulated transcriptional repressor, and to interact with presenilins. Mutations in the presenilin genes have been implicated in Alzheimer's disease.
Uniprot IDQ9Y2W7
Protein Accession #NP_038462
Nucleotide Accession #NM_013434
Protein Size (# AA)256
Molecular Weight29kDa
Protein InteractionsMAVS; CD177; IGLV3-25; IL6ST; IGF1R; KCND2; CLN3; CALM2; KCNIP3; PPP3CA; GRK6; ADRBK1; UBE2I; UBC; PCBD2; TARBP2; PSEN2; CASP3; CREM; CREB1; PSEN1; CRK;
  1. What is the species homology for "CSEN Antibody - N-terminal region (ARP31932_P050)"?

    The tested species reactivity for this item is "Human, Mouse". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish".

  2. How long will it take to receive "CSEN Antibody - N-terminal region (ARP31932_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CSEN Antibody - N-terminal region (ARP31932_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CSEN Antibody - N-terminal region (ARP31932_P050)"?

    This target may also be called "CSEN, DREAM, KCHIP3" in publications.

  5. What is the shipping cost for "CSEN Antibody - N-terminal region (ARP31932_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CSEN Antibody - N-terminal region (ARP31932_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CSEN Antibody - N-terminal region (ARP31932_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "29kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CSEN Antibody - N-terminal region (ARP31932_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "KCNIP3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "KCNIP3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "KCNIP3"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "KCNIP3"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "KCNIP3"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "KCNIP3"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CSEN Antibody - N-terminal region (ARP31932_P050)
Your Rating
We found other products you might like!