Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP31932_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP31932_P050-FITC Conjugated

ARP31932_P050-HRP Conjugated

ARP31932_P050-Biotin Conjugated

CSEN Antibody - N-terminal region (ARP31932_P050)

Catalog#: ARP31932_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species ReactivityHuman, Mouse
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-111016 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human CSEN
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Complete computational species homology dataAnti-CSEN (ARP31932_P050)
Peptide SequenceSynthetic peptide located within the following region: STVRHQPEGLDQLQAQTKFTKKELQSLYRGFKNECPTGLVDEDTFKLIYA
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-KCNIP3 (ARP31932_P050) antibody is Catalog # AAP31932 (Previous Catalog # AAPP02829)
Datasheets/ManualsPrintable datasheet for anti-KCNIP3 (ARP31932_P050) antibody
Target ReferenceZaidi,N.F., et al., (2004) J. Neurochem. 89 (3), 593-601
Publications

Fernandes, V. S. et al. Endogenous hydrogen sulfide has a powerful role in inhibitory neurotransmission to the pig bladder neck. J. Urol. 189, 1567-73 (2013). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 23063804

Gene SymbolKCNIP3
Official Gene Full NameKv channel interacting protein 3, calsenilin
Alias SymbolsCSEN, DREAM, KCHIP3
NCBI Gene Id30818
Protein NameCalsenilin
Description of TargetCSEN is a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belong to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. The protein encoded by this gene is also shown to function as a calcium-regulated transcriptional repressor, and to interact with presenilins. Mutations in the presenilin genes have been implicated in Alzheimer's disease.
Swissprot IdQ9Y2W7
Protein Accession #NP_038462
Nucleotide Accession #NM_013434
Protein Size (# AA)256
Molecular Weight29kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express CSEN.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express CSEN.
Protein InteractionsMAVS; CD177; IGLV3-25; IL6ST; IGF1R; KCND2; CLN3; CALM2; KCNIP3; PPP3CA; GRK6; ADRBK1; UBE2I; UBC; PCBD2; TARBP2; PSEN2; CASP3; CREM; CREB1; PSEN1; CRK;
Write Your Own Review
You're reviewing:CSEN Antibody - N-terminal region (ARP31932_P050)
Your Rating
Free Microscope
Aviva Tips and Tricks
Aviva Live Chat
Aviva Travel Grant