Search Antibody, Protein, and ELISA Kit Solutions

CRY2 Antibody - N-terminal region (ARP52398_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP52398_P050-FITC Conjugated

ARP52398_P050-HRP Conjugated

ARP52398_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Cryptochrome 2 (photolyase-like)
NCBI Gene Id:
Protein Name:
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
FLJ10332, HCRY2, KIAA0658, PHLL2
Replacement Item:
This antibody may replace item sc-130731 from Santa Cruz Biotechnology.
Description of Target:
CRY2 is a blue light-dependent regulator of the circadian feedback loop.CRY2 inhibits CLOCK NPAS2-ARNTL E box-mediated transcription. CRY2 acts, in conjunction with CRY2, in maintaining period length and circadian rhythmicity.CRY2 has no photolyase activity. CRY2 is capable of translocating circadian clock core proteins such as PER proteins to the nucleus.CRY2 may inhibit CLOCK NPAS2-ARNTL transcriptional activity through stabilizing the unphosphorylated form of ARNTL.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CRY2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CRY2.
The immunogen is a synthetic peptide directed towards the N terminal region of human CRY2
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 86%
Complete computational species homology data:
Anti-CRY2 (ARP52398_P050)
Peptide Sequence:
Synthetic peptide located within the following region: IELNGQKPPLTYKRFQAIISRMELPKKPVGLVTSQQMESCRAEIQENHDE
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-CRY2 (ARP52398_P050) antibody is Catalog # AAPP14342
Printable datasheet for anti-CRY2 (ARP52398_P050) antibody

Currie, SP; Doherty, GH; Sillar, KT; Deep-brain photoreception links luminance detection to motor output in Xenopus frog tadpoles. 113, 6053-8 (2016). WB, IHC, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish 27166423

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...