Size:100 ul
Special Price $229.00 Regular Price $319.00
In stock
SKU
ARP52398_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP52398_P050-FITC Conjugated

ARP52398_P050-HRP Conjugated

ARP52398_P050-Biotin Conjugated

More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB, IHC
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-130731 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human CRY2
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 86%
Complete computational species homology data Anti-CRY2 (ARP52398_P050)
Peptide Sequence Synthetic peptide located within the following region: IELNGQKPPLTYKRFQAIISRMELPKKPVGLVTSQQMESCRAEIQENHDE
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-CRY2 (ARP52398_P050) antibody is Catalog # AAPP14342
Datasheets/Manuals Printable datasheet for anti-CRY2 (ARP52398_P050) antibody
Publications

Currie, SP; Doherty, GH; Sillar, KT; Deep-brain photoreception links luminance detection to motor output in Xenopus frog tadpoles. 113, 6053-8 (2016). WB, IHC, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish 27166423

Gene Symbol CRY2
Official Gene Full Name Cryptochrome 2 (photolyase-like)
Alias Symbols FLJ10332, HCRY2, KIAA0658, PHLL2
NCBI Gene Id 1408
Protein Name Cryptochrome-2
Description of Target CRY2 is a blue light-dependent regulator of the circadian feedback loop.CRY2 inhibits CLOCK NPAS2-ARNTL E box-mediated transcription. CRY2 acts, in conjunction with CRY2, in maintaining period length and circadian rhythmicity.CRY2 has no photolyase activity. CRY2 is capable of translocating circadian clock core proteins such as PER proteins to the nucleus.CRY2 may inhibit CLOCK NPAS2-ARNTL transcriptional activity through stabilizing the unphosphorylated form of ARNTL.
Swissprot Id Q49AN0
Protein Accession # NP_066940
Nucleotide Accession # NM_021117
Protein Size (# AA) 593
Molecular Weight 67kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express CRY2.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express CRY2.
Protein Interactions MTUS2; PDE9A; CTBP1; UBC; FBXL3; FBXL21; BTRC; CUL1; SKP1; ATXN1; Csnk1e; PER3; PER2; PER1; PPP5C; TTC1; CRY2; TIMELESS;
Write Your Own Review
You're reviewing:CRY2 Antibody - N-terminal region (ARP52398_P050)
Your Rating