Search Antibody, Protein, and ELISA Kit Solutions

cry1Ac Recombinant Protein (OPCA02931)

* Required Fields

$0.00
In Stock
Request Bulk Order Quote

Swissprot Id:
P05068
Host:
Bacillus thuringiensis subsp. Kurstaki
Molecular Weight:
26 kDa
Product Format:
Liquid
Formulation:
20 mM Tris-HCl based buffer, pH 8.0
Purity:
Greater than 90% as determined by SDS-PAGE.
Protein Sequence:
LYDARNVIKNGDFNNGLSCWNVKGHVDVEEQNNQRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYGEGCVTIHEIENNTDELKFSNCVEEEIYPNNTVTCNDYTVNQEEYGGAYTSRNRGYNEAPSVPADYASVYEEKSYTDGRRENPCEFNRGYRDYTPLPVGYVTKELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
Storage Buffer:
20 mM Tris-HCl based buffer, pH 8.0
Source:
Yeast
Additional Information:
Relevance: Promotes colloidosmotic lysis by binding to the midgut epithelial cells of many lepidopteran larvae.
Tag:
His-tag
Reconstitution and Storage:
Store at -20C. Avoid freeze thaw cycles.
Target Reference:
Characterized full-length and truncated plasmid clones of the crystal protein of Bacillus thuringiensis subsp. kurstaki HD-73 and their toxicity to Manduca sexta.Adang M.J., Staver M.J., Rocheleau T.A., Leighton J., Barker R.F., Thompson D.V.Gene 36:289-300(1985)
Cloning and expression of a Bacillus thuringiensis (L1-2)
gene encoding a crystal protein active against Glossina morsitans morsitans and Chilo partellus.Omolo E.O., James M.D., Osir E.O., Thomson J.A.Curr. Microbiol. 34:118-121(1997)
Herrera G., James M.D. Cloning and nucleotide sequence of an insecticidal crystal protein gene from Bacillus thuringiensis DSIR732 active against 3 species of leafroller (Lepidoptera, Tortricidae)
.Gleave A.P., Hedges R.J., Broadwell A.H., Wigley P.J.N. Z. J. Crop Hortic. Sci. 20:27-36(1992)
Sun M., Yu Z.

Product Reviews

Protocol:
Tips Information:

Tell us what you think about this item!

Write A Review
    Please, wait...