$0.00
In Stock
SKU
OPCA02931
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

cry1Ac Recombinant Protein (OPCA02931)

Catalog#: OPCA02931
Domestic: within 4-6 weeks delivery | International: 4-6 weeks
More Information
Product Format Liquid
Host Bacillus thuringiensis subsp. Kurstaki
Additional Information Relevance: Promotes colloidosmotic lysis by binding to the midgut epithelial cells of many lepidopteran larvae.
Reconstitution and Storage Store at -20C. Avoid freeze thaw cycles.
Formulation 20 mM Tris-HCl based buffer, pH 8.0
Purity Greater than 90% as determined by SDS-PAGE.
Protein Sequence LYDARNVIKNGDFNNGLSCWNVKGHVDVEEQNNQRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYGEGCVTIHEIENNTDELKFSNCVEEEIYPNNTVTCNDYTVNQEEYGGAYTSRNRGYNEAPSVPADYASVYEEKSYTDGRRENPCEFNRGYRDYTPLPVGYVTKELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
Storage Buffer 20 mM Tris-HCl based buffer, pH 8.0
Source Yeast
Tag His-tag
Target Reference Characterized full-length and truncated plasmid clones of the crystal protein of Bacillus thuringiensis subsp. kurstaki HD-73 and their toxicity to Manduca sexta.Adang M.J., Staver M.J., Rocheleau T.A., Leighton J., Barker R.F., Thompson D.V.Gene 36:289-300(1985)
Cloning and expression of a Bacillus thuringiensis (L1-2)
gene encoding a crystal protein active against Glossina morsitans morsitans and Chilo partellus.Omolo E.O., James M.D., Osir E.O., Thomson J.A.Curr. Microbiol. 34:118-121(1997)
Herrera G., James M.D. Cloning and nucleotide sequence of an insecticidal crystal protein gene from Bacillus thuringiensis DSIR732 active against 3 species of leafroller (Lepidoptera, Tortricidae)
.Gleave A.P., Hedges R.J., Broadwell A.H., Wigley P.J.N. Z. J. Crop Hortic. Sci. 20:27-36(1992)
Sun M., Yu Z.
Datasheets/Manuals Printable datasheet for cry1Ac Recombinant Protein (Bacillus thuringiensis subsp. Kurstaki) (OPCA02931)
Swissprot Id P05068
Molecular Weight 26 kDa
Write Your Own Review
You're reviewing:cry1Ac Recombinant Protein (OPCA02931)
Your Rating