Catalog No: OPCA02931
Price: $0.00
SKU
OPCA02931
Availability: Domestic: Antibody & Kits: 2 weeks | Proteins: 4-6 weeks | International: Antibody & Kits: 2 weeks | Proteins: 4-6 weeks
Contact Us:
- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
Shipping Info:
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
CRY1AC Recombinant Protein (Bacillus thuringiensis subsp. kurstaki) (OPCA02931)
Datasheets/Manuals | Printable datasheet for CRY1AC Recombinant Protein (Bacillus thuringiensis subsp. kurstaki) (OPCA02931) (OPCA02931) |
---|
Predicted Species Reactivity | Bacillus thuringiensis |
---|---|
Product Format | Liquid or Lyophilized powder |
Host | Bacillus thuringiensis subsp. Kurstaki |
Additional Information | Relevance: Promotes colloidosmotic lysis by binding to the midgut epithelial cells of many lepidopteran larvae. |
Reconstitution and Storage | -20°C or -80°C |
Formulation | 20 mM Tris-HCl based buffer, pH 8.0 |
Purity | Greater than 90% as determined by SDS-PAGE. |
Peptide Sequence | LYDARNVIKNGDFNNGLSCWNVKGHVDVEEQNNQRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYGEGCVTIHEIENNTDELKFSNCVEEEIYPNNTVTCNDYTVNQEEYGGAYTSRNRGYNEAPSVPADYASVYEEKSYTDGRRENPCEFNRGYRDYTPLPVGYVTKELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE |
Protein Sequence | LYDARNVIKNGDFNNGLSCWNVKGHVDVEEQNNQRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYGEGCVTIHEIENNTDELKFSNCVEEEIYPNNTVTCNDYTVNQEEYGGAYTSRNRGYNEAPSVPADYASVYEEKSYTDGRRENPCEFNRGYRDYTPLPVGYVTKELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE |
Storage Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Source | Yeast |
Protein Range | 972-1178 aa |
Tag | N-terminal 6xHis-tagged |
Reference | Characterized full-length and truncated plasmid clones of the crystal protein of Bacillus thuringiensis subsp. kurstaki HD-73 and their toxicity to Manduca sexta.Adang M.J., Staver M.J., Rocheleau T.A., Leighton J., Barker R.F., Thompson D.V.Gene 36:289-300(1985) |
---|---|
Gene Symbol | CRY1AC |
Alias Symbols | 133 kDa crystal protein;Crystaline entomocidal protoxin;Insecticidal delta-endotoxin CryIA(c). |
Protein Name | Pesticidal crystal protein Cry1Ac |
Description of Target | Promotes colloidosmotic lysis by binding to the midgut epithelial cells of many lepidopteran larvae. |
Uniprot ID | P05068 |
Protein Size (# AA) | Recombinant |
Molecular Weight | 25.8 kDa |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
Write Your Own Review