CRY1AB Recombinant Protein (Bacillus thuringiensis subsp. kurstaki) (OPCA02954)

Catalog No: OPCA02954

cry1Ab Recombinant Protein (Bacillus thuringiensis subsp. Kurstaki) (OPCA02954) in SDS-PAGE showing the molecular weight of approximately 17.3 kDa.

Product Info

• Predicted Species Reactivity: Bacillus thuringiensis
• Product Format: Liquid or Lyophilized powder
• Host: Bacillus thuringiensis subsp. Kurstaki
• Additional Information: Relevance: Promotes colloidosmotic lysis by binding to the midgut epithelial cells of many lepidopteran larvae.
• Reconstitution and Storage: -20°C or -80°C
• Formulation: 20 mM Tris-HCl based buffer, pH 8.0
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: HEIENNTDELKFSNCVEEEVYPNNTVTCNDYTATQEEYEGTYTSRNRGYDGAYESNSSVPADYASAYEEKAYTDGRRDNPCESNRGYGDYTPLPAGYVTKELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
• Protein Sequence: HEIENNTDELKFSNCVEEEVYPNNTVTCNDYTATQEEYEGTYTSRNRGYDGAYESNSSVPADYASAYEEKAYTDGRRDNPCESNRGYGDYTPLPAGYVTKELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Yeast
• Protein Range: 1022-1155 aa
• Tag: N-terminal 6xHis-tagged

Target Info

• Reference: Characterization of Bacillus thuringiensis subsp. kurstaki strain S93 effective against the Fall armyworm, Spodoptera frugiperda and cloning of a cry1Ab gene.Silva-Werneck J.O., De-Souza M.T., Dias J.M.C.S., Ribeiro B.M.Can. J. Microbiol. 45:464-471(1999)
• Gene Symbol: CRY1AB
• Alias Symbols: 130 kDa crystal protein;Crystaline entomocidal protoxin;Insecticidal delta-endotoxin CryIA(b).
• Protein Name: Pesticidal crystal protein Cry1Ab
• Description of Target: Promotes colloidosmotic lysis by binding to the midgut epithelial cells of many lepidopteran larvae.
• Uniprot ID: P0A370
• Protein Accession #: WP_000369819.1
  
• Nucleotide Accession #: NZ_CP010003.1
• Protein Size (# AA): Recombinant
• Molecular Weight: 17.3 kDa