CRY1 Antibody - middle region (ARP89163_P050)

Catalog No: ARP89163_P050

Host: Rabbit
Target Name: CRY1
Sample Tissue: Mouse Pancreas lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Mouse
• Predicted Species Reactivity: Mouse
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse CRY1
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: LLLDADWSINAGSWMWLSCSSFFQQFFHCYCPVGFGRRTDPNGDYIRRYL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-CRY1 (ARP89163_P050) antibody is Catalog # AAP89163

Target Info

• Gene Symbol: CRY1
• Gene Full Name: cryptochrome 1 (photolyase-like)
• Alias Symbols: Ph, Phll1, AU020726, AU021000
• NCBI Gene Id: 12952
• Protein Name: cryptochrome-1
• Description of Target: This gene encodes a flavin adenine dinucleotide-binding protein that is a key component of the circadian core oscillator complex, which regulates the circadian clock. This gene is upregulated by Clock/Arntl heterodimers but then represses this upregulation in a feedback loop using Per/Cry heterodimers to interact with Clock/Arntl. Polymorphisms in this gene have been associated with altered sleep patterns. The encoded protein is widely conserved across plants and animals. Loss of this gene results in a shortened circadian cycle in complete darkness.
• Uniprot ID: P97784
• Protein Accession #: NP_031797.1
• Nucleotide Accession #: NM_007771.3
• Protein Size (# AA): 606
• Molecular Weight: 66 kDa