Now Offering Over 102,157 Antibodies & 44,722 Antigens!

CRSP9 antibody - N-terminal region (ARP33741_P050)

100 ul
$289.00
In Stock

Conjugation Options

ARP33741_P050-FITC Conjugated

ARP33741_P050-HRP Conjugated

ARP33741_P050-Biotin Conjugated

Gene Symbol:
MED7
NCBI Gene Id:
9443
Official Gene Full Name:
Mediator complex subunit 7
Protein Name:
Mediator of RNA polymerase II transcription subunit 7
Swissprot Id:
O43513
Protein Accession #:
NP_004261
Nucleotide Accession #:
NM_004270
Alias Symbols:
ARC34, CRSP9, CRSP33
Replacement Item:
This antibody may replace item sc-101188 from Santa Cruz Biotechnology.
Description of Target:
CRSP9 is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. CRSP9 is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated p
Protein Size (# AA):
233
Molecular Weight:
27kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB, IHC
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CRSP9.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CRSP9.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human CRSP9
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Complete computational species homology data:
Anti-CRSP9 (ARP33741_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MGEPQQVSALPPPPMQYIKEYTDENIQEGLAPKPPPPIKDSYMMFGNQFQ
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
HAUS1; CDK8; CDK19; MED13; MED19; MED26; EPAS1; MED6; UBE2I; UL48; SUMO2; UBC; CTDP1; MED10; MED25; MED15; MED14; VDR; SREBF1; RELA; PARP1; ZSCAN1; TRIM15; RHOXF2; PCBD2; MED31; TRIM29; RBFOX2; IKBKG; LZTR1; PML; MED9; MED8; HGS; MED1; HNF4A; ESR2; ESR1;
Blocking Peptide:
For anti-MED7 (ARP33741_P050) antibody is Catalog # AAP33741 (Previous Catalog # AAPP05138)
Datasheets/Manuals:
Printable datasheet for anti-MED7 (ARP33741_P050) antibody
Sample Type Confirmation:

MED7 is supported by BioGPS gene expression data to be expressed in HEK293T

Subunit:
7
Target Reference:
Ryu,S., et al., (1999) Proc. Natl. Acad. Sci. U.S.A. 96 (13), 7137-7142

Tell us what you think about this item!

Write A Review
    Please, wait...