Search Antibody, Protein, and ELISA Kit Solutions

CRSP9 antibody - N-terminal region (ARP33741_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP33741_P050-FITC Conjugated

ARP33741_P050-HRP Conjugated

ARP33741_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Mediator complex subunit 7
Protein Name:
Mediator of RNA polymerase II transcription subunit 7
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-101188 from Santa Cruz Biotechnology.
Description of Target:
CRSP9 is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. CRSP9 is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated p
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CRSP9.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CRSP9.
The immunogen is a synthetic peptide directed towards the N terminal region of human CRSP9
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Complete computational species homology data:
Anti-CRSP9 (ARP33741_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MGEPQQVSALPPPPMQYIKEYTDENIQEGLAPKPPPPIKDSYMMFGNQFQ
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-MED7 (ARP33741_P050) antibody is Catalog # AAP33741 (Previous Catalog # AAPP05138)
Printable datasheet for anti-MED7 (ARP33741_P050) antibody
Sample Type Confirmation:

MED7 is supported by BioGPS gene expression data to be expressed in HEK293T

Target Reference:
Ryu,S., et al., (1999) Proc. Natl. Acad. Sci. U.S.A. 96 (13), 7137-7142

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...