Size:100 ul
$319.00
In Stock
SKU
ARP34192_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP34192_P050-FITC Conjugated

ARP34192_P050-HRP Conjugated

ARP34192_P050-Biotin Conjugated

CRSP6 Antibody - N-terminal region (ARP34192_P050)

Catalog#: ARP34192_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB, CHIP
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-12453 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human CRSP6
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 92%; Rabbit: 100%; Rat: 100%
Complete computational species homology data Anti-CRSP6 (ARP34192_P050)
Peptide Sequence Synthetic peptide located within the following region: AAQILLKGAERLTKSVTENQENKLQRDFNSELLRLRQHWKLRKVGDKILG
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-MED17 (ARP34192_P050) antibody is Catalog # AAP34192 (Previous Catalog # AAPP05507)
Datasheets/Manuals Printable datasheet for anti-MED17 (ARP34192_P050) antibody
Sample Type Confirmation

MED17 is supported by BioGPS gene expression data to be expressed in HepG2

Subunit 17
Target Reference Wang,Q., et al., (2002) J. Biol. Chem. 277 (45), 42852-42858
Gene Symbol MED17
Official Gene Full Name Mediator complex subunit 17
Alias Symbols CRSP6, CRSP77, DRIP80, TRAP80
NCBI Gene Id 9440
Protein Name Mediator of RNA polymerase II transcription subunit 17
Description of Target The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by CRSP6 is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors.
Swissprot Id Q9NVC6
Protein Accession # NP_004259
Nucleotide Accession # NM_004268
Protein Size (# AA) 651
Molecular Weight 73kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express CRSP6.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express CRSP6.
Protein Interactions UBC; BRCA1; CDK19; CDK8; MED26; POLR2C; ESR2; MED19; FBXW7; EPAS1; TFIP11; MED24; MED21; MED14; MED11; MED28; WDR33; CPSF2; UBD; BCL6; SMARCA4; SUZ12; MED10; CTDP1; SREBF1; MED25; MED15; TRA; MED1; OBFC1; MED18; ZC3H13; MED12; QKI; TRIP4; TADA2A; SUPT7L;
  1. What is the species homology for "CRSP6 Antibody - N-terminal region (ARP34192_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat".

  2. How long will it take to receive "CRSP6 Antibody - N-terminal region (ARP34192_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CRSP6 Antibody - N-terminal region (ARP34192_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CRSP6 Antibody - N-terminal region (ARP34192_P050)"?

    This target may also be called "CRSP6, CRSP77, DRIP80, TRAP80" in publications.

  5. What is the shipping cost for "CRSP6 Antibody - N-terminal region (ARP34192_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CRSP6 Antibody - N-terminal region (ARP34192_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CRSP6 Antibody - N-terminal region (ARP34192_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "73kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CRSP6 Antibody - N-terminal region (ARP34192_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "MED17"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "MED17"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "MED17"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "MED17"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "MED17"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "MED17"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CRSP6 Antibody - N-terminal region (ARP34192_P050)
Your Rating