Search Antibody, Protein, and ELISA Kit Solutions

CRSP6 Antibody - N-terminal region (ARP34192_P050)

100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP34192_P050-FITC Conjugated

ARP34192_P050-HRP Conjugated

ARP34192_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
IHC, WB, CHIP
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-12453 from Santa Cruz Biotechnology.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human CRSP6
Purification:
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 92%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-CRSP6 (ARP34192_P050)
Peptide Sequence:
Synthetic peptide located within the following region: AAQILLKGAERLTKSVTENQENKLQRDFNSELLRLRQHWKLRKVGDKILG
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-MED17 (ARP34192_P050) antibody is Catalog # AAP34192 (Previous Catalog # AAPP05507)
Datasheets/Manuals:
Printable datasheet for anti-MED17 (ARP34192_P050) antibody
Sample Type Confirmation:

MED17 is supported by BioGPS gene expression data to be expressed in HepG2

Subunit:
17
Target Reference:
Wang,Q., et al., (2002) J. Biol. Chem. 277 (45), 42852-42858
Gene Symbol:
MED17
Official Gene Full Name:
Mediator complex subunit 17
Alias Symbols:
CRSP6, CRSP77, DRIP80, TRAP80
NCBI Gene Id:
9440
Protein Name:
Mediator of RNA polymerase II transcription subunit 17
Description of Target:
The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by CRSP6 is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors.
Swissprot Id:
Q9NVC6
Protein Accession #:
NP_004259
Nucleotide Accession #:
NM_004268
Protein Size (# AA):
651
Molecular Weight:
73kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CRSP6.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CRSP6.
Protein Interactions:
UBC; BRCA1; CDK19; CDK8; MED26; POLR2C; ESR2; MED19; FBXW7; EPAS1; TFIP11; MED24; MED21; MED14; MED11; MED28; WDR33; CPSF2; UBD; BCL6; SMARCA4; SUZ12; MED10; CTDP1; SREBF1; MED25; MED15; TRA; MED1; OBFC1; MED18; ZC3H13; MED12; QKI; TRIP4; TADA2A; SUPT7L;

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...