Search Antibody, Protein, and ELISA Kit Solutions

CRMP1 Antibody - N-terminal region (ARP41933_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP41933_P050-FITC Conjugated

ARP41933_P050-HRP Conjugated

ARP41933_P050-Biotin Conjugated

Gene Symbol:
CRMP1
Official Gene Full Name:
Collapsin response mediator protein 1
NCBI Gene Id:
1400
Protein Name:
Dihydropyrimidinase-related protein 1
Swissprot Id:
Q14194
Protein Accession #:
NP_001304
Nucleotide Accession #:
NM_001313
Alias Symbols:
DPYSL1, DRP-1, DRP1, CRMP-1, ULIP-3
Replacement Item:
This antibody may replace item sc-176660 from Santa Cruz Biotechnology.
Description of Target:
CRMP1 is a member of a family of cytosolic phosphoproteins expressed exclusively in the nervous system. The protein is thought to be a part of the semaphorin signal transduction pathway implicated in semaphorin-induced growth cone collapse during neural development.This gene encodes a member of a family of cytosolic phosphoproteins expressed exclusively in the nervous system. The encoded protein is thought to be a part of the semaphorin signal transduction pathway implicated in semaphorin-induced growth cone collapse during neural development. Alternative splicing results in multiple transcript variants. This gene encodes a member of a family of cytosolic phosphoproteins expressed exclusively in the nervous system. The encoded protein is thought to be a part of the semaphorin signal transduction pathway implicated in semaphorin-induced growth cone collapse during neural development. Alternative splicing results in multiple transcript variants.
Protein Size (# AA):
572
Molecular Weight:
62kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB, IP
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CRMP1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CRMP1.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human CRMP1
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Tested Species Reactivity:
Human, Mouse
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 92%; Rabbit: 86%; Rat: 93%; Zebrafish: 86%
Complete computational species homology data:
Anti-CRMP1 (ARP41933_P050)
Peptide Sequence:
Synthetic peptide located within the following region: SYQGKKSIPHITSDRLLIKGGRIINDDQSLYADVYLEDGLIKQIGENLIV
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
AP3M1; DPYSL3; CRMP1; EXOSC8; GOLGA2; DPYSL2; DNAJB4; SEC24C; CUL1; HSPA4; ATP6V1B2; CORO1B; PARVA; OTUD6B; JMJD6; SWAP70; TUBB; TUBA1A; Gne; VIM; HTT; UBC; VCP; UBE2A; TK1; SRC; RGS2; DUSP4; BID; ANXA7; AMFR; YAE1D1; ZAK; DNAJB11; MAPK8IP2; SPRY2; RPS6KA
Blocking Peptide:
For anti-CRMP1 (ARP41933_P050) antibody is Catalog # AAP41933 (Previous Catalog # AAPP24470)
Datasheets/Manuals:
Printable datasheet for anti-CRMP1 (ARP41933_P050) antibody
Target Reference:
Weidemann,W., FEBS Lett. 580 (28-29), 6649-6654 (2006)

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...