CRLS1 Antibody - middle region : FITC (ARP49444_P050-FITC)

Catalog No: ARP49444_P050-FITC

Size:100ul

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: FITC: Fluorescein Isothiocyanate
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CRLS1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
• Peptide Sequence: Synthetic peptide located within the following region: WTIPNMLSMTRIGLAPVLGYLIIEEDFNIALGVFALAGLTDLLDGFIARN
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-CRLS1 (ARP49444_P050-FITC) antibody is Catalog # AAP49444 (Previous Catalog # AAPP29163)
• Publications:

  Croston, T. L. et al. Evaluation of the cardiolipin biosynthetic pathway and its interactions in the diabetic heart. Life Sci. 93, 313-22 (2013). WB, Bovine, Dog, Mouse, Pig, Horse, Rabbit, Rat, Guinea pig, Human, Zebrafish 23872101

Target Info

• Gene Symbol: CRLS1
• Gene Full Name: Cardiolipin synthase 1
• Alias Symbols: CLS, CLS1, GCD10, C20orf155, dJ967N21.6
• NCBI Gene Id: 54675
• Protein Name: Cardiolipin synthase
• Description of Target: CRLS1 catalyzes the reversible phosphatidyl group transfer from one phosphatidylglycerol molecule to another to form cardiolipin (CL) (diphosphatidylglycerol) and glycerol.
• Uniprot ID: Q9UJA2
• Protein Accession #: NP_061968
• Nucleotide Accession #: NM_019095
• Protein Size (# AA): 301
• Molecular Weight: 32kDa
• Protein Interactions: FBXO15; PINK1; UBC; MCM6; MCM7;