Search Antibody, Protein, and ELISA Kit Solutions

CRLS1 Antibody - middle region (ARP49444_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP49444_P050-FITC Conjugated

ARP49444_P050-HRP Conjugated

ARP49444_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
Cardiolipin synthase 1
NCBI Gene Id:
Protein Name:
Cardiolipin synthase
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
C20orf155, CLS1, GCD10, dJ967N21.6, CLS
Replacement Item:
This antibody may replace item sc-514986 from Santa Cruz Biotechnology.
Description of Target:
CRLS1 catalyzes the reversible phosphatidyl group transfer from one phosphatidylglycerol molecule to another to form cardiolipin (CL) (diphosphatidylglycerol) and glycerol.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CRLS1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CRLS1.
The immunogen is a synthetic peptide directed towards the middle region of human CRLS1
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Complete computational species homology data:
Anti-CRLS1 (ARP49444_P050)
Peptide Sequence:
Synthetic peptide located within the following region: WTIPNMLSMTRIGLAPVLGYLIIEEDFNIALGVFALAGLTDLLDGFIARN
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-CRLS1 (ARP49444_P050) antibody is Catalog # AAP49444 (Previous Catalog # AAPP29163)
Printable datasheet for anti-CRLS1 (ARP49444_P050) antibody

Croston, T. L. et al. Evaluation of the cardiolipin biosynthetic pathway and its interactions in the diabetic heart. Life Sci. 93, 313-22 (2013). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 23872101

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...