Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
SKU
ARP49444_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP49444_P050-FITC Conjugated

ARP49444_P050-HRP Conjugated

ARP49444_P050-Biotin Conjugated

CRLS1 Antibody - middle region (ARP49444_P050)

Catalog#: ARP49444_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-514986 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CRLS1
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Complete computational species homology data Anti-CRLS1 (ARP49444_P050)
Peptide Sequence Synthetic peptide located within the following region: WTIPNMLSMTRIGLAPVLGYLIIEEDFNIALGVFALAGLTDLLDGFIARN
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-CRLS1 (ARP49444_P050) antibody is Catalog # AAP49444 (Previous Catalog # AAPP29163)
Datasheets/Manuals Printable datasheet for anti-CRLS1 (ARP49444_P050) antibody
Publications

Croston, T. L. et al. Evaluation of the cardiolipin biosynthetic pathway and its interactions in the diabetic heart. Life Sci. 93, 313-22 (2013). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 23872101

Gene Symbol CRLS1
Official Gene Full Name Cardiolipin synthase 1
Alias Symbols C20orf155, CLS1, GCD10, dJ967N21.6, CLS
NCBI Gene Id 54675
Protein Name Cardiolipin synthase
Description of Target CRLS1 catalyzes the reversible phosphatidyl group transfer from one phosphatidylglycerol molecule to another to form cardiolipin (CL) (diphosphatidylglycerol) and glycerol.
Swissprot Id Q9UJA2
Protein Accession # NP_061968
Nucleotide Accession # NM_019095
Protein Size (# AA) 301
Molecular Weight 32kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express CRLS1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express CRLS1.
Protein Interactions FBXO15; PINK1; UBC; MCM6; MCM7;
Write Your Own Review
You're reviewing:CRLS1 Antibody - middle region (ARP49444_P050)
Your Rating