Catalog No: ARP53580_P050
Price: $0.00
SKU
ARP53580_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

CRISP1 Antibody - N-terminal region (ARP53580_P050)

Datasheets/ManualsPrintable datasheet for anti-CRISP1 (ARP53580_P050) antibody
Product Info
ReferenceMungall,A.J., (2003) Nature 425 (6960), 805-811
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Cow, Dog, Goat, Pig, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human CRISP1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 85%; Dog: 85%; Goat: 85%; Human: 100%; Pig: 85%; Rabbit: 79%; Zebrafish: 100%
Peptide SequenceSynthetic peptide located within the following region: LKMSWSEEAAQNARIFSKYCDMTESNPLERRLPNTFCGENMHMTSYPVSW
Concentration0.5 mg/ml
Blocking PeptideFor anti-CRISP1 (ARP53580_P050) antibody is Catalog # AAP53580 (Previous Catalog # AAPS32908)
Gene SymbolCRISP1
Gene Full NameCysteine-rich secretory protein 1
Alias SymbolsARP, AEGL1, HUMARP, CRISP-1, HEL-S-57, HSCRISP1D, HSCRISP1G
NCBI Gene Id167
Protein NameCysteine-rich secretory protein 1
Description of TargetFertilization consists of a sequence of specific cell-cell interactions culminating in the fusion of the sperm and egg plasma membranes. Recognition, binding, and fusion occur through the interaction of complementary molecules that are localized to specific domains of the sperm and egg plasma membranes. In the sperm, the postacrosomal region or equatorial segment is involved in sperm-egg plasma membrane fusion. CRISP1 is a member of the cysteine-rich secretory protein (CRISP) family. It is expressed in the epididymis, is secreted into the epididymal lumen, and binds to the postacrosomal region of the sperm head where it plays a role at fertilization in sperm-egg fusion through complementary sites localized on the egg surface.Fertilization consists of a sequence of specific cell-cell interactions culminating in the fusion of the sperm and egg plasma membranes. Recognition, binding, and fusion occur through the interaction of complementary molecules that are localized to specific domains of the sperm and egg plasma membranes. In the sperm, the postacrosomal region or equatorial segment is involved in sperm-egg plasma membrane fusion. The protein encoded by this gene is a member of the cysteine-rich secretory protein (CRISP) family. This protein is expressed in the epididymis, is secreted into the epididymal lumen, and binds to the postacrosomal region of the sperm head where it plays a role at fertilization in sperm-egg fusion through complementary sites localized on the egg surface. Two isoforms are encoded by transcript variants of this gene.
Uniprot IDP54107
Protein Accession #NP_001122
Nucleotide Accession #NM_001131
Protein Size (# AA)249
Molecular Weight27kDa
  1. What is the species homology for "CRISP1 Antibody - N-terminal region (ARP53580_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Cow, Dog, Goat, Pig, Rabbit, Zebrafish".

  2. How long will it take to receive "CRISP1 Antibody - N-terminal region (ARP53580_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CRISP1 Antibody - N-terminal region (ARP53580_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CRISP1 Antibody - N-terminal region (ARP53580_P050)"?

    This target may also be called "ARP, AEGL1, HUMARP, CRISP-1, HEL-S-57, HSCRISP1D, HSCRISP1G" in publications.

  5. What is the shipping cost for "CRISP1 Antibody - N-terminal region (ARP53580_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CRISP1 Antibody - N-terminal region (ARP53580_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CRISP1 Antibody - N-terminal region (ARP53580_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "27kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CRISP1 Antibody - N-terminal region (ARP53580_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "CRISP1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CRISP1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CRISP1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CRISP1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CRISP1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CRISP1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CRISP1 Antibody - N-terminal region (ARP53580_P050)
Your Rating
We found other products you might like!