CRHR1 Antibody - C-terminal region (ARP63607_P050)

Catalog No: ARP63607_P050

WB Suggested Anti-CRHR1 Antibody
Titration: 1.0 ug/ml
Positive Control: Hela Whole Cell

Host: Mouse
Target Name: CRHR1
Sample Tissue: Mouse Testis
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human, Mouse
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 100%
• Peptide Sequence: Synthetic peptide located within the following region: RPGVYTDYIYQGPMILVLLINFIFLFNIVRILMTKLRASTTSETIQYRKA
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-CRHR1 (ARP63607_P050) antibody is Catalog # AAP63607
• Publications:

  Proton Sensitivity of Corticotropin-Releasing Hormone Receptor 1 Signaling to Proopiomelanocortin in Male Mice. Endocrinology. 160, 276-291 (2019). 30535142

Target Info

• Gene Symbol: CRHR1
• Gene Full Name: Corticotropin releasing hormone receptor 1
• Alias Symbols: CRF1, CRHR, CRF-R, CRFR1, CRF-R1, CRFR-1, CRH-R1, CRHR1L, CRF-R-1, CRH-R-1
• NCBI Gene Id: 1394
• Protein Name: Corticotropin-releasing factor receptor 1
• Description of Target: This gene encodes a G-protein coupled receptor that binds neuropeptides of the corticotropin releasing hormone family that are major regulators of the hypothalamic-pituitary-adrenal pathway. The encoded protein is essential for the activation of signal transduction pathways that regulate diverse physiological processes including stress, reproduction, immune response and obesity. Alternative splicing results in multiple transcript variants one of which is a non-coding read-through transcript with the neighboring gene MGC57346.
• Uniprot ID: P34998-4
• Protein Accession #: NP_001138620
• Nucleotide Accession #: NM_001145148
• Protein Size (# AA): 401
• Molecular Weight: 44kDa
• Protein Interactions: SRPK1; GNAI1; CALM1; UCN3; CRH; GNAQ; UCN; GNAS; GNAO1;