Catalog No: OPCA02193
Price: $0.00
SKU
OPCA02193
Availability: Domestic: Antibody & Kits: 2 weeks | Proteins: 4-6 weeks | International: Antibody & Kits: 2 weeks | Proteins: 4-6 weeks
Contact Us:
- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
Shipping Info:
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for CREN7 Recombinant Protein (Sulfolobus islandicus) (OPCA02193) |
---|
Predicted Species Reactivity | Sulfolobus islandicus |
---|---|
Product Format | Liquid or Lyophilized powder |
Host | Sulfolobus islandicus |
Additional Information | Relevance: A probable chromatin protein, binds double-strand DNA without sequence specificity. Constrains negative DNA supercoils. |
Reconstitution and Storage | -20°C or -80°C |
Formulation | 20 mM Tris-HCl based buffer, pH 8.0 |
Purity | Greater than 90% as determined by SDS-PAGE. |
Peptide Sequence | MSSGKKAVKVKTPAGKEAELVPEKVWALAPKGRKGVKIGLFKDPETGKYFRHKLPDDYPI |
Protein Sequence | MSSGKKAVKVKTPAGKEAELVPEKVWALAPKGRKGVKIGLFKDPETGKYFRHKLPDDYPI |
Storage Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Source | E.coli |
Protein Range | 1-60 aa |
Tag | N-terminal GST-tagged |
Reference | Biogeography of the Sulfolobus islandicus pan-genome.Reno M.L., Held N.L., Fields C.J., Burke P.V., Whitaker R.J.Proc. Natl. Acad. Sci. U.S.A. 106:8605-8610(2009) |
---|---|
Gene Symbol | LD85_RS06290 |
Gene Full Name | chromatin protein Cren7 |
Alias Symbols | chromatin protein Cren7, LD85_1359, LD85_RS06290. |
NCBI Gene Id | 8761176 |
Protein Name | Chromatin protein Cren7 |
Description of Target | A probable chromatin protein, binds double-strand DNA without sequence specificity. Constrains negative DNA supercoils. |
Uniprot ID | C3MPN0 |
Protein Accession # | WP_012711256.1 |
Nucleotide Accession # | NC_012589.1 |
Protein Size (# AA) | Full Length |
Molecular Weight | 33.6 kDa |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
Write Your Own Review