Size:100 ul
$229.00
In stock
SKU
ARP34777_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP34777_T100-FITC Conjugated

ARP34777_T100-HRP Conjugated

ARP34777_T100-Biotin Conjugated

CREM Antibody - N-terminal region (ARP34777_T100)

Catalog#: ARP34777_T100
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-101530 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human CREM
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 79%
Complete computational species homology data Anti-CREM (ARP34777_T100)
Peptide Sequence Synthetic peptide located within the following region: MAAATGDMPTYQIRAPTAALPQGVVMAASPGSLHSPQQLAEEATRKRELR
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-CREM (ARP34777_T100) antibody is Catalog # AAP34777 (Previous Catalog # AAPP05971)
Datasheets/Manuals Printable datasheet for anti-CREM (ARP34777_T100) antibody
Target Reference Kimura,K., et al., (2006) Genome Res. 16 (1), 55-65
Publications

Sunahori, K., Juang, Y.-T. & Tsokos, G. C. Methylation status of CpG islands flanking a cAMP response element motif on the protein phosphatase 2Ac alpha promoter determines CREB binding and activity. J. Immunol. 182, 1500-8 (2009). WB, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish 19155497

Gene Symbol CREM
Official Gene Full Name CAMP responsive element modulator
Alias Symbols ICER, CREM-2, hCREM-2
NCBI Gene Id 1390
Protein Name cAMP-responsive element modulator
Description of Target CREM is a bZIP transcription factor that binds to the cAMP responsive element found in many viral and cellular promoters. It is an important component of cAMP-mediated signal transduction during the spermatogenetic cycle, as well as other complex processes. Alternative promoter and translation initiation site usage allows this gene to exert spatial and temporal specificity to cAMP responsiveness. Multiple alternatively spliced transcript variants encoding several different isoforms have been found for this gene, with some of them functioning as activators and some as repressors of transcription.
Swissprot Id O75519
Protein Accession # NP_874386
Nucleotide Accession # NM_182717
Protein Size (# AA) 120
Molecular Weight 13kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express CREM.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express CREM.
Protein Interactions CREB1; PIAS3; CASP8AP2; UBE2I; UBC; SP100; ATXN1; EMP3; HHV8GK18_gp81; MAPK3; CREB3L4; HDAC1; CREB3L1; TAF4; CAMK2D; GSK3A; FHL5; GSK3B; KCNIP3; CAMK2G; PRKACA; CSNK1A1; CREBBP; TBP; PRKCA; SPI1; CREM; ATF1; CDC34; CDK1; CSNK2A2; CSNK2A1; CD34;
Write Your Own Review
You're reviewing:CREM Antibody - N-terminal region (ARP34777_T100)
Your Rating