Search Antibody, Protein, and ELISA Kit Solutions

CREM Antibody - N-terminal region (ARP34777_T100)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP34777_T100-FITC Conjugated

ARP34777_T100-HRP Conjugated

ARP34777_T100-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
CAMP responsive element modulator
NCBI Gene Id:
Protein Name:
cAMP-responsive element modulator
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-101530 from Santa Cruz Biotechnology.
Description of Target:
CREM is a bZIP transcription factor that binds to the cAMP responsive element found in many viral and cellular promoters. It is an important component of cAMP-mediated signal transduction during the spermatogenetic cycle, as well as other complex processes. Alternative promoter and translation initiation site usage allows this gene to exert spatial and temporal specificity to cAMP responsiveness. Multiple alternatively spliced transcript variants encoding several different isoforms have been found for this gene, with some of them functioning as activators and some as repressors of transcription.
Protein Size (# AA):
Molecular Weight:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CREM.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CREM.
The immunogen is a synthetic peptide directed towards the N terminal region of human CREM
Predicted Species Reactivity:
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 79%
Complete computational species homology data:
Anti-CREM (ARP34777_T100)
Peptide Sequence:
Synthetic peptide located within the following region: MAAATGDMPTYQIRAPTAALPQGVVMAASPGSLHSPQQLAEEATRKRELR
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-CREM (ARP34777_T100) antibody is Catalog # AAP34777 (Previous Catalog # AAPP05971)
Printable datasheet for anti-CREM (ARP34777_T100) antibody
Target Reference:
Kimura,K., et al., (2006) Genome Res. 16 (1), 55-65

Sunahori, K., Juang, Y.-T. & Tsokos, G. C. Methylation status of CpG islands flanking a cAMP response element motif on the protein phosphatase 2Ac alpha promoter determines CREB binding and activity. J. Immunol. 182, 1500-8 (2009). WB, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish 19155497

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...