Loading...
Catalog No: ARP43609_P050
Price: $0.00
SKU
ARP43609_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-CREBBP (ARP43609_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Additional InformationIHC Information: Colon, Human: Formalin-Fixed, Paraffin-Embedded (FFPE)
IHC Information: Colon, Human: Formalin-Fixed, Paraffin-Embedded (FFPE)
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human CREBBP
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: TPAASQALNPQAQKQVGLATSSPATSQTGPGICMNANFNQTHPGLLNSNS
Concentration0.5 mg/ml
Blocking PeptideFor anti-CREBBP (ARP43609_P050) antibody is Catalog # AAP43609 (Previous Catalog # AAPS13810)
ReferenceXia,Y., (2008) Biochem. Biophys. Res. Commun. 368 (2), 438-444
Publications

p300 Serine 89: A Critical Signaling Integrator and Its Effects on Intestinal Homeostasis and Repair. Cancers (Basel). 13 (2021). 33799418

p300 Serine 89: A Critical Signaling Integrator and Its Effects on Intestinal Homeostasis and Repair. Cancers (Basel). 13 (2021). 34884992

Description
Gene SymbolCREBBP
Gene Full NameCREB binding protein
Alias SymbolsCBP, RSTS, KAT3A, MKHK1, RSTS1
NCBI Gene Id1387
Protein NameCREBBP variant protein EMBL BAE06125.1
Description of TargetCREBBP is involved in the transcriptional coactivation of many different transcription factors. First isolated as a nuclear protein that binds to cAMP-response element binding protein (CREB), this gene is now known to play critical roles in embryonic development, growth control, and homeostasis by coupling chromatin remodeling to transcription factor recognition. CREBBP has intrinsic histone acetyltransferase activity and also acts as a scaffold to stabilize additional protein interactions with the transcription complex. This protein acetylates both histone and non-histone proteins. This protein shares regions of very high sequence similarity with protein p300 in its bromodomain, cysteine-histidine-rich regions, and histone acetyltransferase domain.
Uniprot IDQ4LE28
Protein Accession #NP_001073315
Nucleotide Accession #NM_001079846
Protein Size (# AA)2404
Molecular Weight261kDa
Protein InteractionsSUMO1; UBE2I; UBE2D1; TDG; RELA; CREBBP; KLF2; KLF4; WRN; PSME3; COPS2; UBC; BMI1; EID1; ATF4; DYRK1B; DYRK1A; ATF2; CREB1; CDK2; JUN; PPARG; IRF3; HNF4A; KLF1; vIRF-3; AR; vIRF-1; CNTN2; SMAD3; SMAD2; LDLR; STAT1; K8; MTDH; MEIS1; TLR2; EPAS1; MYBL1; LIG
  1. What is the species homology for "CREBBP Antibody - N-terminal region (ARP43609_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "CREBBP Antibody - N-terminal region (ARP43609_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CREBBP Antibody - N-terminal region (ARP43609_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CREBBP Antibody - N-terminal region (ARP43609_P050)"?

    This target may also be called "CBP, RSTS, KAT3A, MKHK1, RSTS1" in publications.

  5. What is the shipping cost for "CREBBP Antibody - N-terminal region (ARP43609_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CREBBP Antibody - N-terminal region (ARP43609_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CREBBP Antibody - N-terminal region (ARP43609_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "261kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CREBBP Antibody - N-terminal region (ARP43609_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "CREBBP"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CREBBP"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CREBBP"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CREBBP"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CREBBP"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CREBBP"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CREBBP Antibody - N-terminal region (ARP43609_P050)
Your Rating
We found other products you might like!