SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP38790_P050-Biotin
Size:100ul
Price: $434.00
SKU
ARP38790_P050-Biotin
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

CREB3 Antibody - middle region : Biotin (ARP38790_P050-Biotin)

Datasheets/ManualsPrintable datasheet for anti-CREB3 (ARP38790_P050-Biotin) antibody
Product Info
Predicted Species ReactivityHuman, Cow, Dog
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationBiotin
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human CREB3
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 80%; Dog: 80%; Human: 100%
Peptide SequenceSynthetic peptide located within the following region: PPLEWPFPDLFSEPLCRGPILPLQANLTRKGGWLPTGSPSVILQDRYSG
Concentration0.5 mg/ml
Blocking PeptideFor anti-CREB3 (ARP38790_P050-Biotin) antibody is Catalog # AAP38790 (Previous Catalog # AAPP20995)
ReferenceMamdani,F., (er) Am. J. Med. Genet. B Neuropsychiatr. Genet. (2008) In press
Gene SymbolCREB3
Gene Full NameCAMP responsive element binding protein 3
Alias SymbolsLZIP, LUMAN, sLZIP
NCBI Gene Id10488
Protein NameCyclic AMP-responsive element-binding protein 3
Description of TargetCREB3 is a transcription factor that is a member of the leucine zipper family of DNA binding proteins. This protein binds to the cAMP-responsive element, an octameric palindrome. The protein interacts with host cell factor C1, which also associates with the herpes simplex virus (HSV) protein VP16 that induces transcription of HSV immediate-early genes. This protein and VP16 both bind to the same site on host cell factor C1. It is thought that the interaction between this protein and host cell factor C1 plays a role in the establishment of latency during HSV infection. An additional transcript variant has been identified, but its biological validity has not been determined. This gene encodes a transcription factor that is a member of the leucine zipper family of DNA binding proteins. This protein binds to the cAMP-responsive element, an octameric palindrome. The protein interacts with host cell factor C1, which also associates with the herpes simplex virus (HSV) protein VP16 that induces transcription of HSV immediate-early genes. This protein and VP16 both bind to the same site on host cell factor C1. It is thought that the interaction between this protein and host cell factor C1 plays a role in the establishment of latency during HSV infection. An additional transcript variant has been identified, but its biological validity has not been determined. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Uniprot IDO43889
Protein Accession #NP_006359
Nucleotide Accession #NM_006368
Protein Size (# AA)371
Molecular Weight41kDa
Protein InteractionsCOPS5; HCFC1; JUN; CREB3L1; CREB3L3; CREB3; NFE2L3; NFE2L2; DDIT3; CEBPG; ATF4; ATF3; TTLL5; RRAS2; OS9; RABAC1; SQLE; BCAT2; CLP1; UBC; HDAC3; MALL; NFIL3; APPBP2; STX8; BNIP2; CCR1; EMD;
  1. What is the species homology for "CREB3 Antibody - middle region : Biotin (ARP38790_P050-Biotin)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Cow, Dog".

  2. How long will it take to receive "CREB3 Antibody - middle region : Biotin (ARP38790_P050-Biotin)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CREB3 Antibody - middle region : Biotin (ARP38790_P050-Biotin)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CREB3 Antibody - middle region : Biotin (ARP38790_P050-Biotin)"?

    This target may also be called "LZIP, LUMAN, sLZIP" in publications.

  5. What is the shipping cost for "CREB3 Antibody - middle region : Biotin (ARP38790_P050-Biotin)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CREB3 Antibody - middle region : Biotin (ARP38790_P050-Biotin)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CREB3 Antibody - middle region : Biotin (ARP38790_P050-Biotin)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "41kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CREB3 Antibody - middle region : Biotin (ARP38790_P050-Biotin)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "CREB3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CREB3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CREB3"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CREB3"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CREB3"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CREB3"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CREB3 Antibody - middle region : Biotin (ARP38790_P050-Biotin)
Your Rating
We found other products you might like!