- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for anti-CREB1 (ARP39811_P050) antibody |
---|
Tested Species Reactivity | Human |
---|---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human CREB1 |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 86% |
Peptide Sequence | Synthetic peptide located within the following region: TYQIRTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAAREC |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-CREB1 (ARP39811_P050) antibody is Catalog # AAP39811 (Previous Catalog # AAPP21825) |
Sample Type Confirmation | CREB1 is strongly supported by BioGPS gene expression data to be expressed in HT1080 There is BioGPS gene expression data showing that CREB1 is expressed in HEK293 |
Reference | Mamdani,F., Am. J. Med. Genet. B Neuropsychiatr. Genet. 147B (4), 500-504 |
Gene Symbol | CREB1 |
---|---|
Gene Full Name | CAMP responsive element binding protein 1 |
Alias Symbols | CREB, CREB-1 |
NCBI Gene Id | 1385 |
Protein Name | Cyclic AMP-responsive element-binding protein 1 |
Description of Target | CREB1 is a transcription factor that is a member of the leucine zipper family of DNA binding proteins. This protein binds as a homodimer to the cAMP-responsive element, an octameric palindrome. The protein is phosphorylated by several protein kinases, and induces transcription of genes in response to hormonal stimulation of the cAMP pathway. This gene encodes a transcription factor that is a member of the leucine zipper family of DNA binding proteins. This protein binds as a homodimer to the cAMP-responsive element, an octameric palindrome. The protein is phosphorylated by several protein kinases, and induces transcription of genes in response to hormonal stimulation of the cAMP pathway. Alternate splicing of this gene results in two transcript variants encoding different isoforms. |
Uniprot ID | P16220 |
Protein Accession # | NP_604391 |
Nucleotide Accession # | NM_134442 |
Protein Size (# AA) | 341 |
Molecular Weight | 37kDa |
Protein Interactions | UBC; NCOR1; CREM; CREBBP; RPS6KA1; NR5A2; EP300; DEAF1; TP53; CREB1; PRKG1; YAP1; MAPK14; MEIS1; DAXX; TSSK4; AKT1; ATR; SIRT1; SRA1; DR1; ATF7; GSK3B; GSK3A; ATXN3; DNMT3B; RPS6KA5; YY1; RGS13; JUN; HDAC2; HDAC1; CCDC6; PPP1CA; SUMO1; TAF4; POU2F1; MYOD1 |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "CREB1 Antibody - middle region (ARP39811_P050)"?
The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish".
-
How long will it take to receive "CREB1 Antibody - middle region (ARP39811_P050)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "CREB1 Antibody - middle region (ARP39811_P050)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "CREB1 Antibody - middle region (ARP39811_P050)"?
This target may also be called "CREB, CREB-1" in publications.
-
What is the shipping cost for "CREB1 Antibody - middle region (ARP39811_P050)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "CREB1 Antibody - middle region (ARP39811_P050)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "CREB1 Antibody - middle region (ARP39811_P050)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "37kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "CREB1 Antibody - middle region (ARP39811_P050)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "CREB1"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "CREB1"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "CREB1"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "CREB1"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "CREB1"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "CREB1"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.