- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
| Datasheets/Manuals | Printable datasheet for CREB Antibody (Phospho-Ser129) (OAAF07699) |
|---|
| Predicted Species Reactivity | Human|Mouse|Rat |
|---|---|
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | Enzyme-linked immunosorbent assay|Immunocytochemistry|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin|Western blot |
| Additional Information | Modification Sites: Human:S129 Mouse:S129 Rat:S129 |
| Reconstitution and Storage | -20°C |
| Immunogen | The antiserum was produced against synthesized peptide derived from human CREB around the phosphorylation site of Ser129. |
| Purification | The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide. |
| Peptide Sequence | Synthetic peptide located within the following region: LFSGTQISTIAESEDSQESVDSVTDSQKRREILSRRPSYRKILNDLSSDA |
| Concentration | 1mg/ml |
| Specificity | CREB (Phospho-Ser129) Antibody detects endogenous levels of CREB only when phosphorylated at Ser129. |
| Formulation | Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. |
| Application Info | IHC: 1:50~1:100 ELISA: 1:40000 |
| Gene Symbol | CREB1 |
|---|---|
| Gene Full Name | cAMP responsive element binding protein 1 |
| Alias Symbols | active transcription factor CREB;cAMP-response element-binding protein-1;CREB;CREB-1;cyclic adenosine 3',5'-monophosphate response element binding protein;cyclic adenosine 3',5'-monophosphate response element-binding protein CREB;cyclic AMP-responsive element-binding protein 1;transactivator protein. |
| NCBI Gene Id | 1385 |
| Protein Name | Cyclic AMP-responsive element-binding protein 1 |
| Description of Target | Phosphorylation-dependent transcription factor that stimulates transcription upon binding to the DNA cAMP response element (CRE), a sequence present in many viral and cellular promoters. Transcription activation is enhanced by the TORC coactivators which act independently of Ser-133 phosphorylation. Involved in different cellular processes including the synchronization of circadian rhythmicity and the differentiation of adipose cells. |
| Uniprot ID | P16220 |
| Molecular Weight | 36 kda |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "CREB Antibody (Phospho-Ser129) (OAAF07699)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human|Mouse|Rat".
-
How long will it take to receive "CREB Antibody (Phospho-Ser129) (OAAF07699)"?
This item is available "Domestic: within 1-2 week delivery | International: 1-2 weeks".
-
What buffer format is "CREB Antibody (Phospho-Ser129) (OAAF07699)" provided in?
This item is provided in "".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "CREB Antibody (Phospho-Ser129) (OAAF07699)"?
This target may also be called "active transcription factor CREB;cAMP-response element-binding protein-1;CREB;CREB-1;cyclic adenosine 3',5'-monophosphate response element binding protein;cyclic adenosine 3',5'-monophosphate response element-binding protein CREB;cyclic AMP-responsive element-binding protein 1;transactivator protein." in publications.
-
What is the shipping cost for "CREB Antibody (Phospho-Ser129) (OAAF07699)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "CREB Antibody (Phospho-Ser129) (OAAF07699)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "CREB Antibody (Phospho-Ser129) (OAAF07699)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "36 kda".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "CREB Antibody (Phospho-Ser129) (OAAF07699)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "CREB1"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "CREB1"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "CREB1"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "CREB1"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "CREB1"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "CREB1"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.
