Catalog No: OPCA03678
Size:20ug
Price: $449.00
SKU
OPCA03678
Availability: Domestic: Antibody & Kits: 2 weeks | Proteins: 4-6 weeks | International: Antibody & Kits: 2 weeks | Proteins: 4-6 weeks
Contact Us:
- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
Shipping Info:
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for CR2 Recombinant Protein (Mouse) (OPCA03678) (OPCA03678) |
---|
Predicted Species Reactivity | Mouse|Mus musculus |
---|---|
Product Format | Liquid or Lyophilized powder |
Host | Mouse |
Additional Information | Relevance: Receptor for complement C3d. Participates in B lymphocytes activation. |
Reconstitution and Storage | -20°C or -80°C |
Formulation | 20 mM Tris-HCl based buffer, pH 8.0 |
Purity | Greater than 90% as determined by SDS-PAGE. |
Peptide Sequence | ISCDPPPEVKNARKPYYSLPIVPGTVLRYTCSPSYRLIGEKAIFCISENQVHATWDKAPPICESVNKTISCSDPIVPGGFMNKGSKAPFRHGDSVTFTCKANFTMKGSKTVWCQANEMWGPTALPVCESDFPLE |
Protein Sequence | ISCDPPPEVKNARKPYYSLPIVPGTVLRYTCSPSYRLIGEKAIFCISENQVHATWDKAPPICESVNKTISCSDPIVPGGFMNKGSKAPFRHGDSVTFTCKANFTMKGSKTVWCQANEMWGPTALPVCESDFPLE |
Storage Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Source | Mammalian Cells |
Protein Range | 12-145 aa |
Tag | N-terminal 6xHis-tagged |
Reference | Comparative structure and evolution of murine CR2. The homolog of the human C3d/EBV receptor (CD21).Fingeroth J.D.J. Immunol. 144:3458-3467(1990) |
---|---|
Gene Symbol | CR2 |
Alias Symbols | Complement C3d receptor. |
Protein Name | Complement receptor type 2 |
Description of Target | Receptor for complement C3d and for HNRNPU. Participates in B lymphocytes activation. |
Uniprot ID | P19070 |
Protein Size (# AA) | Recombinant |
Molecular Weight | 18.7 kDa |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
Write Your Own Review
We found other products you might like!