CR2 Recombinant Protein (Mouse) (OPCA03318)

Catalog No: OPCA03318

Cr2 Recombinant Protein (Mouse) (OPCA03318) in SDS-PAGE showing the molecular weight of approximately 30.07 kDa.

Product Info

• Predicted Species Reactivity: Mouse|Mus musculus
• Product Format: Liquid or Lyophilized powder
• Host: Mouse
• Additional Information: Relevance: Receptor for complement C3d. Participates in B lymphocytes activation.
• Reconstitution and Storage: -20°C or -80°C
• Formulation: 20 mM Tris-HCl based buffer, pH 8.0
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: LYGNEVSYECDEGFYLLGEKSLQCVNDSKGHGSWSGPPPQCLQSSPLTHCPDPEVKHGYKLNKTHSAFSHNDIVHFVCNQGFIMNGSHLIRCHTNNTWLPGVPTCIRKASLGCQSPSTIPNGNHTGGSIARFPPGMSVMYSCYQGFLMAGEARLICTHEGTWSQPPPFCKEVNCSFPEDTNGIQKGFQPGKTYRFGATVTLECEDGYTLEGSPQSQCQDDSQWNPPLALCKYRRW
• Protein Sequence: LYGNEVSYECDEGFYLLGEKSLQCVNDSKGHGSWSGPPPQCLQSSPLTHCPDPEVKHGYKLNKTHSAFSHNDIVHFVCNQGFIMNGSHLIRCHTNNTWLPGVPTCIRKASLGCQSPSTIPNGNHTGGSIARFPPGMSVMYSCYQGFLMAGEARLICTHEGTWSQPPPFCKEVNCSFPEDTNGIQKGFQPGKTYRFGATVTLECEDGYTLEGSPQSQCQDDSQWNPPLALCKYRRW
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E.coli
• Protein Range: 729-963 aa
• Tag: N-terminal 6xHis-tagged

Target Info

• Reference: Comparative structure and evolution of murine CR2. The homolog of the human C3d/EBV receptor (CD21).Fingeroth J.D.J. Immunol. 144:3458-3467(1990)
• Gene Symbol: CR2
• Alias Symbols: Complement C3d receptor.
• Protein Name: Complement receptor type 2
• Description of Target: Receptor for complement C3d and for HNRNPU. Participates in B lymphocytes activation.
• Uniprot ID: P19070
• Protein Size (# AA): Recombinant
• Molecular Weight: 30 kDa