Search Antibody, Protein, and ELISA Kit Solutions

CPZ Antibody - middle region (ARP80536_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
CPZ
Official Gene Full Name:
carboxypeptidase Z
NCBI Gene Id:
8532
Protein Name:
carboxypeptidase Z
Swissprot Id:
Q66K79-3
Protein Accession #:
NP_001014447.1
Nucleotide Accession #:
NM_001014447.2
Description of Target:
This gene encodes a member of the metallocarboxypeptidase family. This enzyme displays carboxypeptidase activity towards substrates with basic C-terminal residues. It is most active at neutral pH and is inhibited by active site-directed inhibitors of metallocarboxypeptidases. Alternative splicing in the coding region results in multiple transcript variants encoding different isoforms.
Protein Size (# AA):
515
Molecular Weight:
56 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CPZ.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CPZ.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human CPZ
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: AAEGAGYNGWTSGRQNAQNLDLNRNFPDLTSEYYRLAETRGARSDHIPIP
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-CPZ (ARP80536_P050) antibody is Catalog # AAP80536
Datasheets/Manuals:
Printable datasheet for anti-CPZ (ARP80536_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...