CPVL Antibody - middle region (ARP61770_P050)

Catalog No: ARP61770_P050

WB Suggested Anti-CPVL Antibody
Titration: 1.0 ug/ml
Positive Control: MDA-MB-435S Whole Cell

Rabbit Anti-CPVL antibody
Catalog Number: ARP61770
Formalin Fixed Paraffin Embedded Tissue: Human Kidney
Primary antibody Concentration: 1:100
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20x
Exposure Time: 0.5-2.0sec

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 93%; Guinea Pig: 92%; Horse: 92%; Human: 100%; Mouse: 86%; Rabbit: 77%; Rat: 86%
• Peptide Sequence: Synthetic peptide located within the following region: NGIAIGDGYSDPESIIGGYAEFLYQIGLLDEKQKKYFQKQCHECIEHIRK
• Concentration: 0.5 mg/ml
• Blocking Peptide: Catalog # AAP61770

Target Info

• Gene Symbol: CPVL
• Gene Full Name: Carboxypeptidase, vitellogenic-like
• Alias Symbols: HVLP
• NCBI Gene Id: 54504
• Protein Name: Probable serine carboxypeptidase CPVL
• Description of Target: The protein encoded by this gene is a carboxypeptidase and bears strong sequence similarity to serine carboxypeptidases. Carboxypeptidases are a large class of proteases that act to cleave a single amino acid from the carboxy termini of proteins or peptides. The exact function of this protein, however, has not been determined. At least two alternatively spliced transcripts which encode the same protein have been observed.
• Uniprot ID: Q9H3G5
• Protein Accession #: NP_112601
• Nucleotide Accession #: NM_031311
• Protein Size (# AA): 476
• Molecular Weight: 52kDa
• Protein Interactions: CEP57; CDKN1A; CDC20; ASB10; LATS2; FBXO6; UBC; NRBF2; CTNNBIP1; PLRG1;