CPT1B Antibody - N-terminal region (OABB01974)

Catalog No: OABB01974

Size:100UG

Anti-CPT1B Picoband antibody, OABB01974, Western blotting
All lanes: Anti CPT1B (OABB01974) at 0.5ug/ml
Lane 1: Rat Skeletal Muscle Tissue Lysate at 50ug
Lane 2: Rat Cardiac Muscle Tissue Lysate at 50ug
Lane 3: Mouse Skeletal Muscle Tissue Lysate at 50ug
Lane 4: Mouse Cardiac Muscle Tissue Lysate at 50ug
Lane 5: HELA Whole Cell Lysate at 40ug
Predicted bind size: 88KD
Observed bind size: 88KD

Anti-CPT1B Picoband antibody, OABB01974, IHC(P)
IHC(P): Mouse Skeletal Muscle Tissue

Anti-CPT1B Picoband antibody, OABB01974, IHC(P)
IHC(P): Rat Cardiac Muscle Tissue

Product Info

• Tested Species Reactivity: Human, Mouse, Rat
• Predicted Species Reactivity: Mouse|Rat
• Product Format: Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Clonality: Polyclonal
• Clone: Polyclonal
• Isotype: Rabbit IgG
• Host: Rabbit
• Application: Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Frozen|Western blot
• Additional Information: Notes: Tested Species: In-house tested species with positive results.
  By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.
  Other applications have not been tested.
  Optimal dilutions should be determined by end users.
  Background: CPT1B is located on 22q13.33. The protein encoded by this gene, a member of the carnitine/ choline acetyltransferase family, is the rate-controlling enzyme of the long-chain fatty acid beta-oxidation pathway in muscle mitochondria. This enzyme is required for the net transport of long-chain fatty acyl-CoAs from the cytoplasm into the mitochondria. Multiple transcript variants encoding different isoforms have been found for this gene, and read-through transcripts are expressed from the upstream locus that include exons from this gene.
• Reconstitution and Storage: 2°C to 8°C|-20°C
• Immunogen: Polypeptide
• Purification: Affinity Purified
• Peptide Sequence: Synthetic peptide located within the following region: DDEEYYRMELLAKEFQDKTAPRLQKYLVLK
• Concentration: 500 ug/ml
• Specificity: No cross reactivity with other proteins.
• Application Info: Western blot: 0.1-0.5 ug/ml
  Immunohistochemistry (Paraffin-embedded Section): 0.5-1 ug/ml: By Heat
  Immunohistochemistry (Frozen Section): 0.5-1 ug/ml
• Reference: 1. Auinger A; Rubin D; Sabandal M; Helwig U; Rüther A; Schreiber S; Foelsch UR; Döring F; Schrezenmeir J. “A common haplotype of carnitine palmitoyltransferase 1b is associated with the metabolic syndrome”. Br J Nutr, 2013 Mar 14.
  
• Storage Buffer: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Description: Rabbit IgG polyclonal antibody for Carnitine O-palmitoyltransferase 1, muscle isoform (CPT1B) detection. Tested with WB, IHC-P, IHC-F in Human;Mouse;Rat.

Target Info

• Gene Symbol: CPT1B
• Gene Full Name: carnitine palmitoyltransferase 1B
• Alias Symbols: carnitine O-palmitoyltransferase 1, muscle isoform;carnitine O-palmitoyltransferase 1B;Carnitine O-palmitoyltransferase I, muscle isoform;Carnitine palmitoyltransferase 1B;carnitine palmitoyltransferase 1B (muscle);carnitine palmitoyltransferase I-like protein;CPT1M;CPT1-M;CPTI;CPTI-M;MCCPT1;MCPT1;M-CPT1.
• NCBI Gene Id: 1375
• Protein Name: Carnitine O-palmitoyltransferase 1, muscle isoform
• Description of Target: Carnitine O-palmitoyltransferase 1, muscle isoform
• Uniprot ID: Q92523
• Molecular Weight: 87801 MW