Size:100 ul
$319.00
In Stock
SKU
ARP46444_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP46444_P050-FITC Conjugated

ARP46444_P050-HRP Conjugated

ARP46444_P050-Biotin Conjugated

More Information
Tested Species Reactivity Human, Mouse
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-20514 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CPT1B
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 93%; Zebrafish: 92%
Complete computational species homology data Anti-CPT1B (ARP46444_P050)
Peptide Sequence Synthetic peptide located within the following region: DLEMQFQRILDDPSPPQPGEEKLAALTAGGRVEWAQARQAFFSSGKNKAA
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-CPT1B (ARP46444_P050) antibody is Catalog # AAP46444 (Previous Catalog # AAPS18310)
Datasheets/Manuals Printable datasheet for anti-CPT1B (ARP46444_P050) antibody
Sample Type Confirmation

CPT1B is supported by BioGPS gene expression data to be expressed in HT1080

Publications

Jiang, X; Ma, H; Li, C; Cao, Y; Wang, Y; Zhang, Y; Liu, Y; Effects of neonatal dexamethasone administration on cardiac recovery ability under ischemia-reperfusion in 24-wk-old rats. 80, 128-35 (2016). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish 26991264

Li, X; Liu, Y; Ma, H; Guan, Y; Cao, Y; Tian, Y; Zhang, Y; Enhancement of Glucose Metabolism via PGC-1α Participates in the Cardioprotection of Chronic Intermittent Hypobaric Hypoxia. 7, 219 (2016). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish 27375497

Wolf-Johnston, A. S. et al. Alterations in the non-neuronal acetylcholine synthesis and release machinery in esophageal epithelium. Life Sci. 91, 1065-9 (2012). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish 22569297

Gene Symbol CPT1B
Official Gene Full Name Carnitine palmitoyltransferase 1B (muscle)
Alias Symbols CPT1-M, KIAA1670, M-CPT1, CPTI, CPT1M, MCPT1, CPTI-M, MCCPT1
NCBI Gene Id 1375
Protein Name Carnitine O-palmitoyltransferase 1, muscle isoform
Description of Target The protein encoded by this gene, a member of the carnitine/choline acetyltransferase family, is the rate-controlling enzyme of the long-chain fatty acid beta-oxidation pathway in muscle mitochondria. This enzyme is required for the net transport of long-
Swissprot Id Q92523
Protein Accession # NP_004368
Nucleotide Accession # NM_004377
Protein Size (# AA) 772
Molecular Weight 88kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express CPT1B.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express CPT1B.
Protein Interactions C2orf57;
  1. What is the species homology for "CPT1B Antibody - middle region (ARP46444_P050)"?

    The tested species reactivity for this item is "Human, Mouse". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish".

  2. How long will it take to receive "CPT1B Antibody - middle region (ARP46444_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CPT1B Antibody - middle region (ARP46444_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CPT1B Antibody - middle region (ARP46444_P050)"?

    This target may also be called "CPT1-M, KIAA1670, M-CPT1, CPTI, CPT1M, MCPT1, CPTI-M, MCCPT1" in publications.

  5. What is the shipping cost for "CPT1B Antibody - middle region (ARP46444_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CPT1B Antibody - middle region (ARP46444_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CPT1B Antibody - middle region (ARP46444_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "88kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CPT1B Antibody - middle region (ARP46444_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "CPT1B"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CPT1B"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CPT1B"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CPT1B"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CPT1B"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CPT1B"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CPT1B Antibody - middle region (ARP46444_P050)
Your Rating
We found other products you might like!