CPT1B Antibody - middle region (ARP46444_P050)

Catalog No: ARP46444_P050

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/mL of the antibody was used in this experiment.

Host: Mouse
Target Name: CPT1B
Sample Tissue: Mouse Spleen
Antibody Dilution: 1ug/ml

Host: Rabbit
Target Name: CPT1B
Sample Tissue: Mouse Spleen
Antibody Dilution: 1ug/ml

rsearcher: Dr. Pankaj Kumar Singh, UNMC, Omaha, NE
Application: IHC
Species+tissue/cell type:
Species+tissue/cell type: Human Capan1 cells
Primary antibody dilution: 1:300
Secondary antibody: Anti-rabbit Alexa Fluor 488
Secondary antibody dilution:1:200

Product Info

• Tested Species Reactivity: Human, Mouse
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CPT1B
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 93%; Zebrafish: 92%
• Peptide Sequence: Synthetic peptide located within the following region: DLEMQFQRILDDPSPPQPGEEKLAALTAGGRVEWAQARQAFFSSGKNKAA
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-CPT1B (ARP46444_P050) antibody is Catalog # AAP46444 (Previous Catalog # AAPS18310)
• Sample Type Confirmation:

  CPT1B is supported by BioGPS gene expression data to be expressed in HT1080

• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Publications:

  Effects of neonatal dexamethasone administration on cardiac recovery ability under ischemia-reperfusion in 24-wk-old rats. Pediatr. Res. 80, 128-35 (2016). 26991264

  Enhancement of Glucose Metabolism via PGC-1a Participates in the Cardioprotection of Chronic Intermittent Hypobaric Hypoxia. Front Physiol. 7, 219 (2016). 27375497

  Wolf-Johnston, A. S. et al. Alterations in the non-neuronal acetylcholine synthesis and release machinery in esophageal epithelium. Life Sci. 91, 1065-9 (2012). 22569297

Target Info

• Gene Symbol: CPT1B
• Gene Full Name: Carnitine palmitoyltransferase 1B (muscle)
• Alias Symbols: CPTI, CPT1M, MCPT1, CPT1-M, CPTI-M, M-CPT1, MCCPT1
• NCBI Gene Id: 1375
• Protein Name: Carnitine O-palmitoyltransferase 1, muscle isoform
• Description of Target: The protein encoded by this gene, a member of the carnitine/choline acetyltransferase family, is the rate-controlling enzyme of the long-chain fatty acid beta-oxidation pathway in muscle mitochondria. This enzyme is required for the net transport of long-
• Uniprot ID: Q92523
• Protein Accession #: NP_004368
• Nucleotide Accession #: NM_004377
• Protein Size (# AA): 772
• Molecular Weight: 88 kDa
• Protein Interactions: C2orf57;