Size:100 ul
$319.00
In stock
SKU
ARP46444_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP46444_P050-FITC Conjugated

ARP46444_P050-HRP Conjugated

ARP46444_P050-Biotin Conjugated

CPT1B Antibody - middle region (ARP46444_P050)

Rating:
100% of 100
Catalog#: ARP46444_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species ReactivityHuman, Mouse
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-20514 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human CPT1B
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 93%; Zebrafish: 92%
Complete computational species homology dataAnti-CPT1B (ARP46444_P050)
Peptide SequenceSynthetic peptide located within the following region: DLEMQFQRILDDPSPPQPGEEKLAALTAGGRVEWAQARQAFFSSGKNKAA
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-CPT1B (ARP46444_P050) antibody is Catalog # AAP46444 (Previous Catalog # AAPS18310)
Datasheets/ManualsPrintable datasheet for anti-CPT1B (ARP46444_P050) antibody
Sample Type Confirmation

CPT1B is supported by BioGPS gene expression data to be expressed in HT1080

Publications

Jiang, X; Ma, H; Li, C; Cao, Y; Wang, Y; Zhang, Y; Liu, Y; Effects of neonatal dexamethasone administration on cardiac recovery ability under ischemia-reperfusion in 24-wk-old rats. 80, 128-35 (2016). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish 26991264

Li, X; Liu, Y; Ma, H; Guan, Y; Cao, Y; Tian, Y; Zhang, Y; Enhancement of Glucose Metabolism via PGC-1α Participates in the Cardioprotection of Chronic Intermittent Hypobaric Hypoxia. 7, 219 (2016). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish 27375497

Wolf-Johnston, A. S. et al. Alterations in the non-neuronal acetylcholine synthesis and release machinery in esophageal epithelium. Life Sci. 91, 1065-9 (2012). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish 22569297

Gene SymbolCPT1B
Official Gene Full NameCarnitine palmitoyltransferase 1B (muscle)
Alias SymbolsCPT1-M, KIAA1670, M-CPT1, CPTI, CPT1M, MCPT1, CPTI-M, MCCPT1
NCBI Gene Id1375
Protein NameCarnitine O-palmitoyltransferase 1, muscle isoform
Description of TargetThe protein encoded by this gene, a member of the carnitine/choline acetyltransferase family, is the rate-controlling enzyme of the long-chain fatty acid beta-oxidation pathway in muscle mitochondria. This enzyme is required for the net transport of long-
Swissprot IdQ92523
Protein Accession #NP_004368
Nucleotide Accession #NM_004377
Protein Size (# AA)772
Molecular Weight88kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express CPT1B.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express CPT1B.
Protein InteractionsC2orf57;
Write Your Own Review
You're reviewing:CPT1B Antibody - middle region (ARP46444_P050)
Your Rating
Free Microscope
Aviva Travel Grant
Aviva ChIP Antibodies
Aviva HIS tag Deal