CPT1B Antibody - middle region (ARP46444_P050)

1 Review(s) | Add Your Review

Catalog#: ARP46444_P050
Domestic: within 1-2 days delivery International: 1-2 days

Human Capan1

Human 293T

Mouse Spleen

Human 293T Whole Cell

Human PANC1 Whole Cell

Hela, Human liver

Human Capan1

Size:	100 ul
Price:	$319.00
Availability: In Stock
Qty:
Request Bulk Order Quote

Aviva's Satisfaction Guarantee

Conjugation Options

ARP46444_P050-FITC Conjugated

ARP46444_P050-HRP Conjugated

ARP46444_P050-Biotin Conjugated

Gene Symbol:: CPT1B
Official Gene Full Name:: Carnitine palmitoyltransferase 1B (muscle)
NCBI Gene Id:: 1375
Protein Name:: Carnitine O-palmitoyltransferase 1, muscle isoform
Swissprot Id:: Q92523
Protein Accession #:: NP_004368
Nucleotide Accession #:: NM_004377
Alias Symbols:: CPT1-M, KIAA1670, M-CPT1, CPTI, CPT1M, MCPT1, CPTI-M, MCCPT1
Replacement Item:: This antibody may replace item sc-20514 from Santa Cruz Biotechnology.
Description of Target:: The protein encoded by this gene, a member of the carnitine/choline acetyltransferase family, is the rate-controlling enzyme of the long-chain fatty acid beta-oxidation pathway in muscle mitochondria. This enzyme is required for the net transport of long-
Protein Size (# AA):: 772
Molecular Weight:: 88kDa
Host:: Rabbit
Clonality:: Polyclonal
Purification:: Affinity Purified
Application:: IHC, WB
Tissue Tool:: Find tissues and cell lines supported by DNA array analysis to express CPT1B.
RNA Seq:: Find tissues and cell lines supported by RNA-seq analysis to express CPT1B.
Immunogen:: The immunogen is a synthetic peptide directed towards the middle region of human CPT1B
Predicted Species Reactivity:: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Tested Species Reactivity:: Human, Mouse
Predicted Homology Based on Immunogen Sequence:: Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 93%; Zebrafish: 92%
Complete computational species homology data:: Anti-CPT1B (ARP46444_P050)
Peptide Sequence:: Synthetic peptide located within the following region: DLEMQFQRILDDPSPPQPGEEKLAALTAGGRVEWAQARQAFFSSGKNKAA
Product Format:: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:: Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:: C2orf57;
Blocking Peptide:: For anti-CPT1B (ARP46444_P050) antibody is Catalog # AAP46444 (Previous Catalog # AAPS18310)
Datasheets/Manuals:: Printable datasheet for anti-CPT1B (ARP46444_P050) antibody
Sample Type Confirmation:: CPT1B is supported by BioGPS gene expression data to be expressed in HT1080

Publications:

Jiang, X; Ma, H; Li, C; Cao, Y; Wang, Y; Zhang, Y; Liu, Y; Effects of neonatal dexamethasone administration on cardiac recovery ability under ischemia-reperfusion in 24-wk-old rats. 80, 128-35 (2016). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish 26991264

Li, X; Liu, Y; Ma, H; Guan, Y; Cao, Y; Tian, Y; Zhang, Y; Enhancement of Glucose Metabolism via PGC-1Î± Participates in the Cardioprotection of Chronic Intermittent Hypobaric Hypoxia. 7, 219 (2016). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish 27375497

Wolf-Johnston, A. S. et al. Alterations in the non-neuronal acetylcholine synthesis and release machinery in esophageal epithelium. Life Sci. 91, 1065-9 (2012). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish 22569297

Product Reviews

Protocol:

Tips Information:

See our General FAQ page.

Product Protocols: CPT1B antibody tested with Human Ht1080 Cells (ARP46444_P050)

Product Review: CPT1B antibody-middle region (ARP46444_P050) in Human Capan1 cells using IHC

Biological pathways

Name	# of Products
Carnitine shuttle	18
Fatty acid beta-oxidation	64
Regulation of fatty acid oxidation	44

Biological process

Name	# of Products
Carnitine shuttle	7
Cellular lipid metabolic process	114
Fatty acid beta-oxidation	31
Fatty acid metabolic process	78
Regulation of fatty acid oxidation	17
Small molecule metabolic process	825
Transport	555

Cellular components

Name	# of Products
Integral to membrane	2793
Membrane	2769
Microsome	250
Mitochondrial outer membrane	89
Mitochondrion	1154

Protein function

Name	# of Products
Carnitine O-palmitoyltransferase activity	9
Transferase activity, transferring acyl groups	205

Average Rating:

1 review

Write A Review

5 star

4 star

3 star

2 star

1 star

Result filter:

Verified Buyers

Date - Newest First
Date - Newest First
Date - Latest First
Highest Rated
Lowest Rated
Most Helpful
Ownership

Aviva Customer 02/01/2017 03/01/201716:23

Overall Experience:
Quality:

Product Review: CPT1B antibody-middle region (ARP46444_P050) in human capan1 cell lysate using Western blot

Product Page for CPT1B antibody-middle region (ARP46444_P050)

Researcher: Dr. Pankaj Kumar Singh, UNMC, Omaha, NE
Application: Western blotting
Species + Tissue/Cell type: 1: 45ug human capan1 cell lysate
Primary antibody dilution: 1:1000
Secondary antibody: Anti-rabbit HRP
Secondary antibody dilution: 1:5000

Questionnaire:
How do Aviva's reagents play a role in your experimental goals?	Used in different biochemical characterization.
How would you rate this antibody on a scale from 1-5 (5=best) and why?	5/5, Specific band.
Would you use this antibody in future experiments?	Yes
Have you used another antibody which has worked in your application?	No
Do you believe the information about the reagent on Aviva's website is correct?	Almost correct.
If the antibody works, do you plan to use it in future experiments or to publish your data? Why or why not?	We are planning to use it for some of the future experiments.
How did you store the antibody after re-suspension?	At -20C in small aliquots.
Sample Description (please include 1) species type, and 2) cell/tissue type, and 3) how much protein loaded for each lane of your gel):	Human, Pancreatic cancer cell line Capan1, 45 ug
How many different experimental trials were conducted using the antibody sample?	1
How was this sample prepared?	Cells were lysed in RIPA buffer
Primary antibody dilution and incubation time:	1:1000, Overnight at 4C.
Secondary antibody used and dilution and incubation time:	1:5000, 2 hour, RT.
What controls were used in your experiment (positive/negative)?	Beta-tubulin.
Please include your detailed WB Procedure/Protocol here:	1- Prepared the 10 % SDS-PAGE gel. 2- Loaded 45 ug of total protein (Cell lysate) along with molecular weight markers. 3- Run the gel initially at 70V, till the dye reached up to the separating gel and then at 110V till the time dye reached to bottom. 4- Cut PVDF membrane to the same size of the gel. Soaked the membrane in 100% Methanol for 10sec then in water for 20 sec and finally 20 min in transfer buffer. 5- Arranged the Electro-transfer apparatus with gel-membrane sandwich and connected to the power supply at constant Amp (225 mA) for 1hour. 6- Disconnected the transfer apparatus and transferred the membrane in blocking solution [5% Skimmed in PBST (0.1%)] for 1 hour. 7- After blocking transferred the membrane in Primary antibody solution (1:1000 dilutions in PBST) and incubated at 4C for over-night. 8- Washed the membrane 3 times with PBST (0.1%) for 10 minutes each. 9- Incubated the membrane with respective secondary antibody (1:5000 dilutions in PBST) for 2 hour at room temperature. 10- Washed the membrane 3 times with PBST (0.1%) for 10 minutes each. 11- Developed the blots using standard protocol.

Show more comments (-2) Hide comments

What kind of abuse are you reporting?

Unwanted advertising content or spam
Pornography or sexually explicit material
Hate speech or graphic violence
Harassment or bullying
Copyrighted material

CPT1B Antibody - middle region (ARP46444_P050)

Human Capan1

Human 293T

Mouse Spleen

Mouse Spleen

Human 293T Whole Cell

Human PANC1 Whole Cell

Hela, Human liver

Human Capan1