CPT1B Antibody - middle region (ARP46444_P050)

Size:100 ul

Human Capan1

Human 293T

Mouse Spleen

Mouse Spleen

Human 293T Whole Cell

Human PANC1 Whole Cell

Hela, Human liver

Human Capan1

Basic Info

• Tested Species Reactivity: Human, Mouse
• Predicted Species Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Replacement Item: This antibody may replace item sc-20514 from Santa Cruz Biotechnology.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CPT1B
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 93%; Zebrafish: 92%
• Complete computational species homology data: Anti-CPT1B (ARP46444_P050)
• Peptide Sequence: Synthetic peptide located within the following region: DLEMQFQRILDDPSPPQPGEEKLAALTAGGRVEWAQARQAFFSSGKNKAA
• Concentration: Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
• Blocking Peptide: For anti-CPT1B (ARP46444_P050) antibody is Catalog # AAP46444 (Previous Catalog # AAPS18310)
• Datasheets/Manuals: Printable datasheet for anti-CPT1B (ARP46444_P050) antibody
• Sample Type Confirmation:

  CPT1B is supported by BioGPS gene expression data to be expressed in HT1080

• Publications:

  Jiang, X; Ma, H; Li, C; Cao, Y; Wang, Y; Zhang, Y; Liu, Y; Effects of neonatal dexamethasone administration on cardiac recovery ability under ischemia-reperfusion in 24-wk-old rats. 80, 128-35 (2016). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish 26991264

  Li, X; Liu, Y; Ma, H; Guan, Y; Cao, Y; Tian, Y; Zhang, Y; Enhancement of Glucose Metabolism via PGC-1α Participates in the Cardioprotection of Chronic Intermittent Hypobaric Hypoxia. 7, 219 (2016). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish 27375497

  Wolf-Johnston, A. S. et al. Alterations in the non-neuronal acetylcholine synthesis and release machinery in esophageal epithelium. Life Sci. 91, 1065-9 (2012). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish 22569297

Target Info

• Gene Symbol: CPT1B
• Official Gene Full Name: Carnitine palmitoyltransferase 1B (muscle)
• Alias Symbols: CPT1-M, KIAA1670, M-CPT1, CPTI, CPT1M, MCPT1, CPTI-M, MCCPT1
• NCBI Gene Id: 1375
• Protein Name: Carnitine O-palmitoyltransferase 1, muscle isoform
• Description of Target: The protein encoded by this gene, a member of the carnitine/choline acetyltransferase family, is the rate-controlling enzyme of the long-chain fatty acid beta-oxidation pathway in muscle mitochondria. This enzyme is required for the net transport of long-
• Swissprot Id: Q92523
• Protein Accession #: NP_004368
• Nucleotide Accession #: NM_004377
• Protein Size (# AA): 772
• Molecular Weight: 88kDa
• Tissue Tool: Find tissues and cell lines supported by DNA array analysis to express CPT1B.
• RNA Seq: Find tissues and cell lines supported by RNA-seq analysis to express CPT1B.
• Protein Interactions: C2orf57;