- Tested Species Reactivity:
- Human, Mouse
- Predicted Species Reactivity:
- Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
- Product Format:
- Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Application:
- IHC, WB
- Reconstitution and Storage:
- For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
- Gene Symbol:
- CPT1B
- Official Gene Full Name:
- Carnitine palmitoyltransferase 1B (muscle)
- NCBI Gene Id:
- 1375
- Protein Name:
- Carnitine O-palmitoyltransferase 1, muscle isoform
- Swissprot Id:
- Q92523
- Protein Accession #:
- NP_004368
- Nucleotide Accession #:
- NM_004377
- Alias Symbols:
- CPT1-M, KIAA1670, M-CPT1, CPTI, CPT1M, MCPT1, CPTI-M, MCCPT1
- Replacement Item:
- This antibody may replace item sc-20514 from Santa Cruz Biotechnology.
- Description of Target:
- The protein encoded by this gene, a member of the carnitine/choline acetyltransferase family, is the rate-controlling enzyme of the long-chain fatty acid beta-oxidation pathway in muscle mitochondria. This enzyme is required for the net transport of long-
- Protein Size (# AA):
- 772
- Molecular Weight:
- 88kDa
- Purification:
- Affinity Purified
- Tissue Tool:
- Find tissues and cell lines supported by DNA array analysis to express CPT1B.
- RNA Seq:
- Find tissues and cell lines supported by RNA-seq analysis to express CPT1B.
- Immunogen:
- The immunogen is a synthetic peptide directed towards the middle region of human CPT1B
- Predicted Homology Based on Immunogen Sequence:
- Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 93%; Zebrafish: 92%
- Complete computational species homology data:
- Anti-CPT1B (ARP46444_P050)
- Peptide Sequence:
- Synthetic peptide located within the following region: DLEMQFQRILDDPSPPQPGEEKLAALTAGGRVEWAQARQAFFSSGKNKAA
- Concentration:
- Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
- Protein Interactions:
- C2orf57;
- Blocking Peptide:
- For anti-CPT1B (ARP46444_P050) antibody is Catalog # AAP46444 (Previous Catalog # AAPS18310)
- Datasheets/Manuals:
- Printable datasheet for anti-CPT1B (ARP46444_P050) antibody
- Sample Type Confirmation:
CPT1B is supported by BioGPS gene expression data to be expressed in HT1080
- Publications:
Jiang, X; Ma, H; Li, C; Cao, Y; Wang, Y; Zhang, Y; Liu, Y; Effects of neonatal dexamethasone administration on cardiac recovery ability under ischemia-reperfusion in 24-wk-old rats. 80, 128-35 (2016). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish 26991264
Li, X; Liu, Y; Ma, H; Guan, Y; Cao, Y; Tian, Y; Zhang, Y; Enhancement of Glucose Metabolism via PGC-1α Participates in the Cardioprotection of Chronic Intermittent Hypobaric Hypoxia. 7, 219 (2016). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish 27375497
Wolf-Johnston, A. S. et al. Alterations in the non-neuronal acetylcholine synthesis and release machinery in esophageal epithelium. Life Sci. 91, 1065-9 (2012). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish 22569297
Product Reviews
- Protocol:
- Tips Information:
See our General FAQ page.
Result filter:
- Date - Newest First
- Date - Newest First
- Date - Latest First
- Highest Rated
- Lowest Rated
- Most Helpful
- Ownership
