Aviva Systems Biology will be closed in observance of Good Friday 3/29/2024. If you are in need of any assistance please email info@avivasysbio.com

Catalog No: ARP40697_T100
Price: $0.00
SKU
ARP40697_T100
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-CPSF6 (ARP40697_T100) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIF, IHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human CPSF6
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Peptide SequenceSynthetic peptide located within the following region: PPLAGPPNRGDRPPPPVLFPGQPFGQPPLGPLPPGPPPPVPGYGPPPGPP
Concentration1.0 mg/ml
Blocking PeptideFor anti-CPSF6 (ARP40697_T100) antibody is Catalog # AAP40697 (Previous Catalog # AAPY00949)
Sample Type Confirmation

CPSF6 is strongly supported by BioGPS gene expression data to be expressed in Jurkat

ReferenceRual,J.F., (2005) Nature 437 (7062), 1173-1178
Gene SymbolCPSF6
Gene Full NameCleavage and polyadenylation specific factor 6, 68kDa
Alias SymbolsCFIM, CFIM68, CFIM72, HPBRII-4, HPBRII-7
NCBI Gene Id11052
Protein NameCleavage and polyadenylation specificity factor subunit 6
Description of TargetCPSF6 is one subunit of a cleavage factor required for 3' RNA cleavage and polyadenylation processing. The interaction of the protein with the RNA is one of the earliest steps in the assembly of the 3' end processing complex and facilitates the recruitement of other processing factors. The cleavage factor complex is composed of four polypeptides.The protein encoded by this gene is one subunit of a cleavage factor required for 3' RNA cleavage and polyadenylation processing. The interaction of the protein with the RNA is one of the earliest steps in the assembly of the 3' end processing complex and facilitates the recruitement of other processing factors. The cleavage factor complex is composed of four polypeptides. This gene encodes the 68kD subunit. It has a domain organization reminiscent of spliceosomal proteins.
Uniprot IDQ16630
Protein Accession #NP_008938
Nucleotide Accession #NM_007007
Protein Size (# AA)551
Molecular Weight61kDa
Protein InteractionsARMC7; OTUB2; TOLLIP; PPIL1; FUS; FXR2; WWOX; EZH2; SUZ12; EED; rev; ITCH; PRPF40A; WBP4; TCERG1; NEDD4; APBB1; SRPK2; WWP1; NUDT21; LMNA; CD81; TP63; UBC; NPM1; FN1; DAB2; CSNK2A1; SMURF1; BARD1; MDC1; ZBTB8B; CPSF7; NUP107; TBC1D2; WBP11; PUF60; U2AF2;
  1. What is the species homology for "CPSF6 Antibody - middle region (ARP40697_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish".

  2. How long will it take to receive "CPSF6 Antibody - middle region (ARP40697_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CPSF6 Antibody - middle region (ARP40697_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CPSF6 Antibody - middle region (ARP40697_T100)"?

    This target may also be called "CFIM, CFIM68, CFIM72, HPBRII-4, HPBRII-7" in publications.

  5. What is the shipping cost for "CPSF6 Antibody - middle region (ARP40697_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CPSF6 Antibody - middle region (ARP40697_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CPSF6 Antibody - middle region (ARP40697_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "61kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CPSF6 Antibody - middle region (ARP40697_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "CPSF6"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CPSF6"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CPSF6"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CPSF6"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CPSF6"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CPSF6"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CPSF6 Antibody - middle region (ARP40697_T100)
Your Rating