CPSF4 Recombinant Protein (Human) (OPCA05044)

Catalog No: OPCA05044

Product Info

• Predicted Species Reactivity: Homo sapiens|Human
• Product Format: Liquid or Lyophilized powder
• Additional Information: Species Specificity Detail: Homo sapiens (Human)
• Reconstitution and Storage: -20°C or -80°C
• Formulation: Tris-base, 50% glycerol
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: MQEIIASVDHIKFDLEIAVEQQLGAQPLPFPGMDKSGAAVCEFFLKAACGKGGMCPFRHISGEKTVVCKHWLRGLCKKGDQCEFLHEYDMTKMPECYFYSKFGECSNKECPFLHIDPESKIKDCPWYDRGFCKHGPLCRHRHTRRVICVNYLVGFCPEGPSCKFMHPRFELPMGTTEQPPLPQQTQPPAKQRTPQVIGVMQSQNSSAGNRGPRPLEQVTCYKCGEKGHYANRCTKGHLAFLSGQ
• Protein Sequence: MQEIIASVDHIKFDLEIAVEQQLGAQPLPFPGMDKSGAAVCEFFLKAACGKGGMCPFRHISGEKTVVCKHWLRGLCKKGDQCEFLHEYDMTKMPECYFYSKFGECSNKECPFLHIDPESKIKDCPWYDRGFCKHGPLCRHRHTRRVICVNYLVGFCPEGPSCKFMHPRFELPMGTTEQPPLPQQTQPPAKQRTPQVIGVMQSQNSSAGNRGPRPLEQVTCYKCGEKGHYANRCTKGHLAFLSGQ
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E.coli
• Protein Range: 1-244 aa
• Tag: N-terminal GST-tagged
• Reference: Assignment of the human homolog of the zebrafish essential gene no arches to 7q22.1. Kawakami K., Gaiano N., Grosshans D., Scherer S., Tsui L.-C., Hopkins N. Submitted (NOV-1996)

Target Info

• Gene Symbol: CPSF4
• Gene Full Name: cleavage and polyadenylation specific factor 4
• Alias Symbols: cleavage and polyadenylation specific factor 4, 30kDa;cleavage and polyadenylation specificity factor 30 kDa subunit;cleavage and polyadenylation specificity factor subunit 4;CPSF 30 kDa subunit;CPSF30;NAR;NEB1;NEB-1;no arches homolog;no arches-like zinc finger protein;NS1 effector domain-binding protein 1.
• NCBI Gene Id: 10898
• Protein Name: Cleavage and polyadenylation specificity factor subunit 4
• Description of Target: Component of the cleavage and polyadenylation specificity factor (CPSF) complex that play a key role in pre-mRNA 3'-end formation, recognizing the AAUAAA signal sequence and interacting with poly(A) polymerase and other factors to bring about cleavage and poly(A) addition. CPSF4 binds RNA polymers with a preference for poly(U).
• Uniprot ID: O95639
• Protein Accession #: NP_001075028
• Nucleotide Accession #: NM_001081559
• Protein Size (# AA): Recombinant
• Molecular Weight: 54.5 kDa