Search Antibody, Protein, and ELISA Kit Solutions

CPE Antibody - N-terminal region (ARP58445_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP58445_P050-FITC Conjugated

ARP58445_P050-HRP Conjugated

ARP58445_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Carboxypeptidase E
NCBI Gene Id:
Protein Name:
Carboxypeptidase E
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-116451 from Santa Cruz Biotechnology.
Description of Target:
CPE is a carboxypeptidase that cleaves C-terminal amino acid residues and is involved in the biosynthesis of peptide hormones and neurotransmitters, including insulin. It is a peripheral membrane protein. The protein specifically binds regulated secretory pathway proteins, including prohormones, but not constitutively secreted proteinsThis gene encodes a carboxypeptidase that cleaves C-terminal amino acid residues and is involved in the biosynthesis of peptide hormones and neurotransmitters, including insulin. It is a peripheral membrane protein. The protein specifically binds regulated secretory pathway proteins, including prohormones, but not constitutively secreted proteins. Mutations in this gene are implicated in type II diabetes. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CPE.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CPE.
The immunogen is a synthetic peptide directed towards the N terminal region of human CPE
Predicted Species Reactivity:
Cow, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%
Complete computational species homology data:
Anti-CPE (ARP58445_P050)
Peptide Sequence:
Synthetic peptide located within the following region: GMRRRRRLQQEDGISFEYHRYPELREALVSVWLQCTAISRIYTVGRSFEG
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-CPE (ARP58445_P050) antibody is Catalog # AAP58445 (Previous Catalog # AAPP34556)
Printable datasheet for anti-CPE (ARP58445_P050) antibody
Sample Type Confirmation:

CPE is strongly supported by BioGPS gene expression data to be expressed in HepG2

CPE is supported by BioGPS gene expression data to be expressed in MCF7

Target Reference:
Wang,J., (2008) Acta Pharmacol. Sin. 29 (6), 736-744

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...