Now Offering Over 102,157 Antibodies & 44,722 Antigens!

CPE antibody - N-terminal region (ARP58445_P050)

100 ul
$289.00
In Stock

Conjugation Options

ARP58445_P050-FITC Conjugated

ARP58445_P050-HRP Conjugated

ARP58445_P050-Biotin Conjugated

Gene Symbol:
CPE
NCBI Gene Id:
1363
Official Gene Full Name:
Carboxypeptidase E
Protein Name:
Carboxypeptidase E
Swissprot Id:
P16870
Protein Accession #:
NP_001864
Nucleotide Accession #:
NM_001873
Alias Symbols:
-
Replacement Item:
This antibody may replace item sc-116451 from Santa Cruz Biotechnology.
Description of Target:
CPE is a carboxypeptidase that cleaves C-terminal amino acid residues and is involved in the biosynthesis of peptide hormones and neurotransmitters, including insulin. It is a peripheral membrane protein. The protein specifically binds regulated secretory pathway proteins, including prohormones, but not constitutively secreted proteinsThis gene encodes a carboxypeptidase that cleaves C-terminal amino acid residues and is involved in the biosynthesis of peptide hormones and neurotransmitters, including insulin. It is a peripheral membrane protein. The protein specifically binds regulated secretory pathway proteins, including prohormones, but not constitutively secreted proteins. Mutations in this gene are implicated in type II diabetes. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
476
Molecular Weight:
52kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CPE.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CPE.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human CPE
Species Reactivity:
Cow, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%
Complete computational species homology data:
Anti-CPE (ARP58445_P050)
Peptide Sequence:
Synthetic peptide located within the following region: GMRRRRRLQQEDGISFEYHRYPELREALVSVWLQCTAISRIYTVGRSFEG
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
PRKAA1; UBC; LRIF1; POLDIP2; MED31; ROBO2; POLA2; CHD3; TRH; NTS; GTF3C1; UTP14A; RPA1; PMCH; INS; GCG; GAST; CCK; BDNF;
Blocking Peptide:
For anti-CPE (ARP58445_P050) antibody is Catalog # AAP58445 (Previous Catalog # AAPP34556)
Datasheets/Manuals:
Printable datasheet for anti-CPE (ARP58445_P050) antibody
Sample Type Confirmation:

CPE is strongly supported by BioGPS gene expression data to be expressed in HepG2

CPE is supported by BioGPS gene expression data to be expressed in MCF7

Target Reference:
Wang,J., (2008) Acta Pharmacol. Sin. 29 (6), 736-744

Tell us what you think about this item!

Write A Review
    Please, wait...