Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
SKU
ARP58445_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP58445_P050-FITC Conjugated

ARP58445_P050-HRP Conjugated

ARP58445_P050-Biotin Conjugated

CPE Antibody - N-terminal region (ARP58445_P050)

Catalog#: ARP58445_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-116451 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human CPE
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%
Complete computational species homology dataAnti-CPE (ARP58445_P050)
Peptide SequenceSynthetic peptide located within the following region: GMRRRRRLQQEDGISFEYHRYPELREALVSVWLQCTAISRIYTVGRSFEG
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-CPE (ARP58445_P050) antibody is Catalog # AAP58445 (Previous Catalog # AAPP34556)
Datasheets/ManualsPrintable datasheet for anti-CPE (ARP58445_P050) antibody
Sample Type Confirmation

CPE is strongly supported by BioGPS gene expression data to be expressed in HepG2

CPE is supported by BioGPS gene expression data to be expressed in MCF7

Target ReferenceWang,J., (2008) Acta Pharmacol. Sin. 29 (6), 736-744
Gene SymbolCPE
Official Gene Full NameCarboxypeptidase E
Alias Symbols-
NCBI Gene Id1363
Protein NameCarboxypeptidase E
Description of TargetCPE is a carboxypeptidase that cleaves C-terminal amino acid residues and is involved in the biosynthesis of peptide hormones and neurotransmitters, including insulin. It is a peripheral membrane protein. The protein specifically binds regulated secretory pathway proteins, including prohormones, but not constitutively secreted proteinsThis gene encodes a carboxypeptidase that cleaves C-terminal amino acid residues and is involved in the biosynthesis of peptide hormones and neurotransmitters, including insulin. It is a peripheral membrane protein. The protein specifically binds regulated secretory pathway proteins, including prohormones, but not constitutively secreted proteins. Mutations in this gene are implicated in type II diabetes. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot IdP16870
Protein Accession #NP_001864
Nucleotide Accession #NM_001873
Protein Size (# AA)476
Molecular Weight52kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express CPE.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express CPE.
Protein InteractionsPRKAA1; UBC; LRIF1; POLDIP2; MED31; ROBO2; POLA2; CHD3; TRH; NTS; GTF3C1; UTP14A; RPA1; PMCH; INS; GCG; GAST; CCK; BDNF;
Write Your Own Review
You're reviewing:CPE Antibody - N-terminal region (ARP58445_P050)
Your Rating
Aviva Pathways
Aviva Tissue Tool
Aviva Travel Grant
Assay Development