Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP58445_P050-FITC Conjugated

ARP58445_P050-HRP Conjugated

ARP58445_P050-Biotin Conjugated

CPE Antibody - N-terminal region (ARP58445_P050)

Catalog#: ARP58445_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-116451 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human CPE
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%
Complete computational species homology dataAnti-CPE (ARP58445_P050)
Peptide SequenceSynthetic peptide located within the following region: GMRRRRRLQQEDGISFEYHRYPELREALVSVWLQCTAISRIYTVGRSFEG
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-CPE (ARP58445_P050) antibody is Catalog # AAP58445 (Previous Catalog # AAPP34556)
Datasheets/ManualsPrintable datasheet for anti-CPE (ARP58445_P050) antibody
Sample Type Confirmation

CPE is strongly supported by BioGPS gene expression data to be expressed in HepG2

CPE is supported by BioGPS gene expression data to be expressed in MCF7

Target ReferenceWang,J., (2008) Acta Pharmacol. Sin. 29 (6), 736-744
Gene SymbolCPE
Official Gene Full NameCarboxypeptidase E
Alias Symbols-
NCBI Gene Id1363
Protein NameCarboxypeptidase E
Description of TargetCPE is a carboxypeptidase that cleaves C-terminal amino acid residues and is involved in the biosynthesis of peptide hormones and neurotransmitters, including insulin. It is a peripheral membrane protein. The protein specifically binds regulated secretory pathway proteins, including prohormones, but not constitutively secreted proteinsThis gene encodes a carboxypeptidase that cleaves C-terminal amino acid residues and is involved in the biosynthesis of peptide hormones and neurotransmitters, including insulin. It is a peripheral membrane protein. The protein specifically binds regulated secretory pathway proteins, including prohormones, but not constitutively secreted proteins. Mutations in this gene are implicated in type II diabetes. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot IdP16870
Protein Accession #NP_001864
Nucleotide Accession #NM_001873
Protein Size (# AA)476
Molecular Weight52kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express CPE.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express CPE.
  1. What is the species homology for "CPE Antibody - N-terminal region (ARP58445_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish".

  2. How long will it take to receive "CPE Antibody - N-terminal region (ARP58445_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CPE Antibody - N-terminal region (ARP58445_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact

  4. What are other names for "CPE Antibody - N-terminal region (ARP58445_P050)"?

    This target may also be called "-" in publications.

  5. What is the shipping cost for "CPE Antibody - N-terminal region (ARP58445_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CPE Antibody - N-terminal region (ARP58445_P050)"?

    All Aviva products have been through vigorous validations and carry 100% satisfaction warranty.

  7. Can I get bulk pricing for "CPE Antibody - N-terminal region (ARP58445_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "52kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CPE Antibody - N-terminal region (ARP58445_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "CPE"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CPE"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CPE"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CPE"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CPE"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CPE"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CPE Antibody - N-terminal region (ARP58445_P050)
Your Rating
Aviva Pathways
Free Microscope
Assay Development
Aviva Blast Tool