Catalog No: ARP66547_P050
Price: $0.00
SKU
ARP66547_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for ARP66547_P050
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of Human COX7A2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 85%; Dog: 85%; Guinea Pig: 85%; Horse: 85%; Human: 100%; Mouse: 77%; Rabbit: 85%; Rat: 77%; Sheep: 85%; Zebrafish: 75%
Peptide SequenceSynthetic peptide located within the following region: ASRRHFKNKVPEKQKLFQEDDEIPLYLKGGVADALLYRATMILTVGGTAY
Concentration0.5 mg/ml
Blocking PeptideCatalog # AAP66547
Sample Type Confirmation

COX7A2 is supported by BioGPS gene expression data to be expressed in MCF7

Gene SymbolCOX7A2
Gene Full Namecytochrome c oxidase subunit VIIa polypeptide 2 (liver)
Alias SymbolsVIIAL, COX7AL, COX7AL1, COXVIIAL, COXVIIa-L
NCBI Gene Id1347
Protein NameCytochrome c oxidase subunit 7A2, mitochondrial Ensembl ENSP00000359106 Ensembl ENSP00000359098
Description of TargetCytochrome c oxidase, the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of three catalytic subunits encoded by mitochondrial genes, and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, while the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes polypeptide 2 (liver isoform) of subunit VIIa, with this polypeptide being present in both muscle and non-muscle tissues. In addition to polypeptide 2, subunit VIIa includes polypeptide 1 (muscle isoform), which is present only in muscle tissues, and a related protein, which is present in all tissues.
Uniprot IDH0UI06
Protein Accession #NP_001856
Nucleotide Accession #NM_001865
Protein Size (# AA)115
Molecular Weight12kDa
Protein InteractionsTCF3; PET100; UBC;
  1. What is the species homology for "COX7A2 Antibody - middle region (ARP66547_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish".

  2. How long will it take to receive "COX7A2 Antibody - middle region (ARP66547_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "COX7A2 Antibody - middle region (ARP66547_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "COX7A2 Antibody - middle region (ARP66547_P050)"?

    This target may also be called "VIIAL, COX7AL, COX7AL1, COXVIIAL, COXVIIa-L" in publications.

  5. What is the shipping cost for "COX7A2 Antibody - middle region (ARP66547_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "COX7A2 Antibody - middle region (ARP66547_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "COX7A2 Antibody - middle region (ARP66547_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "12kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "COX7A2 Antibody - middle region (ARP66547_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "COX7A2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "COX7A2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "COX7A2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "COX7A2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "COX7A2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "COX7A2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:COX7A2 Antibody - middle region (ARP66547_P050)
Your Rating
We found other products you might like!