- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
COX7A2 Antibody - middle region (ARP66547_P050)
Datasheets/Manuals | Printable datasheet for ARP66547_P050 |
---|
Tested Species Reactivity | Human |
---|---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human COX7A2 |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Cow: 85%; Dog: 85%; Guinea Pig: 85%; Horse: 85%; Human: 100%; Mouse: 77%; Rabbit: 85%; Rat: 77%; Sheep: 85%; Zebrafish: 75% |
Peptide Sequence | Synthetic peptide located within the following region: ASRRHFKNKVPEKQKLFQEDDEIPLYLKGGVADALLYRATMILTVGGTAY |
Concentration | 0.5 mg/ml |
Blocking Peptide | Catalog # AAP66547 |
Sample Type Confirmation | COX7A2 is supported by BioGPS gene expression data to be expressed in MCF7 |
Gene Symbol | COX7A2 |
---|---|
Gene Full Name | cytochrome c oxidase subunit VIIa polypeptide 2 (liver) |
Alias Symbols | VIIAL, COX7AL, COX7AL1, COXVIIAL, COXVIIa-L |
NCBI Gene Id | 1347 |
Protein Name | Cytochrome c oxidase subunit 7A2, mitochondrial Ensembl ENSP00000359106 Ensembl ENSP00000359098 |
Description of Target | Cytochrome c oxidase, the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of three catalytic subunits encoded by mitochondrial genes, and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, while the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes polypeptide 2 (liver isoform) of subunit VIIa, with this polypeptide being present in both muscle and non-muscle tissues. In addition to polypeptide 2, subunit VIIa includes polypeptide 1 (muscle isoform), which is present only in muscle tissues, and a related protein, which is present in all tissues. |
Uniprot ID | H0UI06 |
Protein Accession # | NP_001856 |
Nucleotide Accession # | NM_001865 |
Protein Size (# AA) | 115 |
Molecular Weight | 12kDa |
Protein Interactions | TCF3; PET100; UBC; |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "COX7A2 Antibody - middle region (ARP66547_P050)"?
The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish".
-
How long will it take to receive "COX7A2 Antibody - middle region (ARP66547_P050)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "COX7A2 Antibody - middle region (ARP66547_P050)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "COX7A2 Antibody - middle region (ARP66547_P050)"?
This target may also be called "VIIAL, COX7AL, COX7AL1, COXVIIAL, COXVIIa-L" in publications.
-
What is the shipping cost for "COX7A2 Antibody - middle region (ARP66547_P050)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "COX7A2 Antibody - middle region (ARP66547_P050)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "COX7A2 Antibody - middle region (ARP66547_P050)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "12kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "COX7A2 Antibody - middle region (ARP66547_P050)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "COX7A2"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "COX7A2"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "COX7A2"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "COX7A2"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "COX7A2"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "COX7A2"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.