Search Antibody, Protein, and ELISA Kit Solutions

Cox6a1 Antibody - C-terminal region (ARP41557_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP41557_P050-FITC Conjugated

ARP41557_P050-HRP Conjugated

ARP41557_P050-Biotin Conjugated

Tested Species Reactivity:
Mouse
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Cox6a1
Official Gene Full Name:
Cytochrome c oxidase, subunit VI a, polypeptide 1
NCBI Gene Id:
12861
Protein Name:
Cytochrome c oxidase subunit 6A, mitochondrial RuleBase RU004397
Swissprot Id:
Q9DCW5
Protein Accession #:
NP_031774
Nucleotide Accession #:
NM_007748
Alias Symbols:
VIaL
Replacement Item:
This antibody may replace item sc-142527 from Santa Cruz Biotechnology.
Description of Target:
The function of this protein remains unknown.
Protein Size (# AA):
112
Molecular Weight:
12kDa
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express Cox6a1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express Cox6a1.
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 93%; Rat: 93%; Zebrafish: 79%
Complete computational species homology data:
Anti-Cox6a1 (ARP41557_P050)
Peptide Sequence:
Synthetic peptide located within the following region: FLKSRHEEHERPPFVAYPHLRIRTKPFPWGDGNHTLFHNPHVNPLPTGYE
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
SNCA;
Blocking Peptide:
For anti-Cox6a1 (ARP41557_P050) antibody is Catalog # AAP41557
Datasheets/Manuals:
Printable datasheet for anti-Cox6a1 (ARP41557_P050) antibody
Subunit:
6A1, mitochondrial

Product Reviews

Average Rating:
1 review
5 star
0
4 star
0
3 star
1
2 star
0
1 star
0
  • Date - Newest First
  • Date - Newest First
  • Date - Latest First
  • Highest Rated
  • Lowest Rated
  • Most Helpful
  • Ownership

1 Item(s)

269/09/2018 21:28
  • Quality:
  • Overall Experience:
Mouse, Human Cell Lines in WB

Anonymously Submitted

1. Sample type/lane description: C2C12 cell line (mouse myoblast cells); HEK293T cell line (human embryonic kidney cells)

Lane 1: 2% C2C12 cell lysate

Lane 2: 2% HEK293T cell lysate

2. Primary antibody dilution: 1:200 antibody dilution in 5% milk (non-fat powdered milk) in 0.1% Triton-X100 in 1X PBS.

3. Secondary antibody and dilution: Goat Anti-Rabbit Peroxidase - 1:500 antibody dilution in 5% milk (non-fat powdered milk) in 0.1% Triton-X100 in 1X PBS.

 

Overall this antibody seems to work relatively well in that it detects COX6A1 in HEK293T cells. However, almost no COX6A1 should be present in the C2C12 sample. Therefore, it does not work well for accurately assessing quantity of COX6A1 protein present and it may not be isoform specific to COX6A1 but may instead detect COX6A2 (~11kD) as well as it seems to detect a band in C2C12 cells.

 

0
0
Reply
Show more comments (-2) Hide comments

1 Item(s)

What kind of abuse are you reporting?
    Please, wait...