COX4I1 Recombinant Protein (Human) (OPCA01536)

Catalog No: OPCA01536

COX4I1 Recombinant Protein (Human) (OPCA01536) in SDS-PAGE showing the molecular weight of approximately 33.2 kDa.

COX4I1 Recombinant Protein (Human) (OPCA01536) in SDS-PAGE showing the molecular weight of approximately 33.2 kDa.

Product Info

• Predicted Species Reactivity: Homo sapiens|Human
• Product Format: Liquid or Lyophilized powder
• Host: Human
• Additional Information: Relevance: This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.
• Reconstitution and Storage: -20°C or -80°C
• Formulation: 20 mM Tris-HCl based buffer, pH 8.0
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: AHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEWKTVVGGAMFFIGFTALVIMWQKHYVYGPLPQSFDKEWVAKQTKRMLDMKVNPIQGLASKWDYEKNEWKK
• Protein Sequence: AHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEWKTVVGGAMFFIGFTALVIMWQKHYVYGPLPQSFDKEWVAKQTKRMLDMKVNPIQGLASKWDYEKNEWKK
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E.coli
• Protein Range: 23-169 aa
• Tag: N-terminal 6xHis-SUMO-tagged
• Reference: Isolation of a cDNA clone encoding subunit IV of human cytochrome c oxidase.Zeviani M., Nakagawa M., Herbert J., Lomax M.I., Grossman L.I., Sherbany A.A., Miranda A.F., Dimauro S., Schon E.A.Gene 55:205-217(1987)

Target Info

• Gene Symbol: COX4I1
• Gene Full Name: cytochrome c oxidase subunit 4I1
• Alias Symbols: COX IV-1;COX4;COX4-1;COXIV;COXIV-1;cytochrome c oxidase polypeptide IV;cytochrome c oxidase subunit 4 isoform 1, mitochondrial;cytochrome c oxidase subunit IV;Cytochrome c oxidase subunit IV isoform 1;MC4DN16.
• NCBI Gene Id: 1327
• Protein Name: Cytochrome c oxidase subunit 4 isoform 1, mitochondrial
• Description of Target: This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.
• Uniprot ID: P13073
• Protein Accession #: NP_001852.1
  
• Nucleotide Accession #: NM_001861.3
• Protein Size (# AA): Recombinant
• Molecular Weight: 33.2 kDa