Size:100 ul
Special Price $229.00 Regular Price $249.00
In Stock
SKU
ARP42784_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP42784_T100-FITC Conjugated

ARP42784_T100-HRP Conjugated

ARP42784_T100-Biotin Conjugated

COX4I1 Antibody - N-terminal region (ARP42784_T100)

Rating:
100% of 100
Catalog#: ARP42784_T100
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB, IP
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-292052 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human COX4I1
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 86%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 85%; Rabbit: 86%; Rat: 86%
Complete computational species homology data Anti-COX4I1 (ARP42784_T100)
Peptide Sequence Synthetic peptide located within the following region: AISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALK
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-COX4I1 (ARP42784_T100) antibody is Catalog # AAP42784 (Previous Catalog # AAPS10110)
Datasheets/Manuals Printable datasheet for anti-COX4I1 (ARP42784_T100) antibody
Sample Type Confirmation

COX4I1 is strongly supported by BioGPS gene expression data to be expressed in HepG2

Subunit 4 isoform 1, mitochondrial
Target Reference Williams,S.L., (2004) J. Biol. Chem. 279 (9), 7462-7469
Publications

Geerling, J. J. et al. Metformin lowers plasma triglycerides by promoting VLDL-triglyceride clearance by brown adipose tissue in mice. Diabetes 63, 880-91 (2014). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 24270984

Snyder, A. M. et al. Mitochondrial ferritin in the substantia nigra in restless legs syndrome. J. Neuropathol. Exp. Neurol. 68, 1193-9 (2009). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 19816198

Gene Symbol COX4I1
Official Gene Full Name Cytochrome c oxidase subunit IV isoform 1
Alias Symbols COX4, COXIV, MGC72016, COX4-1
NCBI Gene Id 1327
Protein Name Cytochrome c oxidase subunit 4 isoform 1, mitochondrial
Description of Target Cytochrome c oxidase (COX) is the terminal enzyme of the mitochondrial respiratory chain. It is a multi-subunit enzyme complex that couples the transfer of electrons from cytochrome c to molecular oxygen and contributes to a proton electrochemical gradient across the inner mitochondrial membrane. The complex consists of 13 mitochondrial- and nuclear-encoded subunits. The mitochondrially-encoded subunits perform the electron transfer and proton pumping activities. The functions of the nuclear-encoded subunits are unknown but they may play a role in the regulation and assembly of the complex. COX4I1 is the nuclear-encoded subunit IV isoform 1 of the human mitochondrial respiratory chain enzyme.Cytochrome c oxidase (COX) is the terminal enzyme of the mitochondrial respiratory chain. It is a multi-subunit enzyme complex that couples the transfer of electrons from cytochrome c to molecular oxygen and contributes to a proton electrochemical gradient across the inner mitochondrial membrane. The complex consists of 13 mitochondrial- and nuclear-encoded subunits. The mitochondrially-encoded subunits perform the electron transfer and proton pumping activities. The functions of the nuclear-encoded subunits are unknown but they may play a role in the regulation and assembly of the complex. This gene encodes the nuclear-encoded subunit IV isoform 1 of the human mitochondrial respiratory chain enzyme. It is located at the 3' of the NOC4 (neighbor of COX4) gene in a head-to-head orientation, and shares a promoter with it.
Swissprot Id P13073
Protein Accession # NP_001852
Nucleotide Accession # NM_001861
Protein Size (# AA) 169
Molecular Weight 19kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express COX4I1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express COX4I1.
Protein Interactions SDCBP; COX1; env; APP; UBC; ICT1; TMBIM4; NELFCD;
  1. What is the species homology for "COX4I1 Antibody - N-terminal region (ARP42784_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat".

  2. How long will it take to receive "COX4I1 Antibody - N-terminal region (ARP42784_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "COX4I1 Antibody - N-terminal region (ARP42784_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "COX4I1 Antibody - N-terminal region (ARP42784_T100)"?

    This target may also be called "COX4, COXIV, MGC72016, COX4-1" in publications.

  5. What is the shipping cost for "COX4I1 Antibody - N-terminal region (ARP42784_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "COX4I1 Antibody - N-terminal region (ARP42784_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "COX4I1 Antibody - N-terminal region (ARP42784_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "19kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "COX4I1 Antibody - N-terminal region (ARP42784_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "COX4I1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "COX4I1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "COX4I1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "COX4I1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "COX4I1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "COX4I1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:COX4I1 Antibody - N-terminal region (ARP42784_T100)
Your Rating
We found other products you might like!