Loading...
Catalog No: ARP42784_T100
Price: $0.00
SKU
ARP42784_T100
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-COX4I1 (ARP42784_T100) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB, IP
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human COX4I1
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 86%; Dog: 86%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 85%; Rabbit: 86%; Rat: 86%
Peptide SequenceSynthetic peptide located within the following region: AISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALK
Concentration1.0 mg/ml
Blocking PeptideFor anti-COX4I1 (ARP42784_T100) antibody is Catalog # AAP42784 (Previous Catalog # AAPS10110)
Sample Type Confirmation

COX4I1 is strongly supported by BioGPS gene expression data to be expressed in HepG2

Subunit4 isoform 1, mitochondrial
ReferenceWilliams,S.L., (2004) J. Biol. Chem. 279 (9), 7462-7469
Publications

Geerling, J. J. et al. Metformin lowers plasma triglycerides by promoting VLDL-triglyceride clearance by brown adipose tissue in mice. Diabetes 63, 880-91 (2014). 24270984

Snyder, A. M. et al. Mitochondrial ferritin in the substantia nigra in restless legs syndrome. J. Neuropathol. Exp. Neurol. 68, 1193-9 (2009). 19816198

Gene SymbolCOX4I1
Gene Full NameCytochrome c oxidase subunit IV isoform 1
Alias SymbolsCOX4, COXIV, COX4-1, COXIV-1, MC4DN16, COX IV-1
NCBI Gene Id1327
Protein NameCytochrome c oxidase subunit 4 isoform 1, mitochondrial
Description of TargetCytochrome c oxidase (COX) is the terminal enzyme of the mitochondrial respiratory chain. It is a multi-subunit enzyme complex that couples the transfer of electrons from cytochrome c to molecular oxygen and contributes to a proton electrochemical gradient across the inner mitochondrial membrane. The complex consists of 13 mitochondrial- and nuclear-encoded subunits. The mitochondrially-encoded subunits perform the electron transfer and proton pumping activities. The functions of the nuclear-encoded subunits are unknown but they may play a role in the regulation and assembly of the complex. COX4I1 is the nuclear-encoded subunit IV isoform 1 of the human mitochondrial respiratory chain enzyme.Cytochrome c oxidase (COX) is the terminal enzyme of the mitochondrial respiratory chain. It is a multi-subunit enzyme complex that couples the transfer of electrons from cytochrome c to molecular oxygen and contributes to a proton electrochemical gradient across the inner mitochondrial membrane. The complex consists of 13 mitochondrial- and nuclear-encoded subunits. The mitochondrially-encoded subunits perform the electron transfer and proton pumping activities. The functions of the nuclear-encoded subunits are unknown but they may play a role in the regulation and assembly of the complex. This gene encodes the nuclear-encoded subunit IV isoform 1 of the human mitochondrial respiratory chain enzyme. It is located at the 3' of the NOC4 (neighbor of COX4) gene in a head-to-head orientation, and shares a promoter with it.
Uniprot IDP13073
Protein Accession #NP_001852
Nucleotide Accession #NM_001861
Protein Size (# AA)169
Molecular Weight19kDa
Protein InteractionsSDCBP; COX1; env; APP; UBC; ICT1; TMBIM4; NELFCD;
  1. What is the species homology for "COX4I1 Antibody - N-terminal region (ARP42784_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "COX4I1 Antibody - N-terminal region (ARP42784_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "COX4I1 Antibody - N-terminal region (ARP42784_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "COX4I1 Antibody - N-terminal region (ARP42784_T100)"?

    This target may also be called "COX4, COXIV, COX4-1, COXIV-1, MC4DN16, COX IV-1" in publications.

  5. What is the shipping cost for "COX4I1 Antibody - N-terminal region (ARP42784_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "COX4I1 Antibody - N-terminal region (ARP42784_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "COX4I1 Antibody - N-terminal region (ARP42784_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "19kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "COX4I1 Antibody - N-terminal region (ARP42784_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "COX4I1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "COX4I1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "COX4I1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "COX4I1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "COX4I1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "COX4I1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:COX4I1 Antibody - N-terminal region (ARP42784_T100)
Your Rating
We found other products you might like!