- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for anti-COX15 (ARP46442_T100-HRP) antibody |
---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish |
---|---|
Product Format | Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
Clonality | Polyclonal |
Host | Rabbit |
Conjugation | HRP: Horseradish Peroxidase |
Application | IHC, WB |
Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human COX15 |
Predicted Homology Based on Immunogen Sequence | Cow: 93%; Dog: 86%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 86%; Rat: 93%; Yeast: 82%; Zebrafish: 79% |
Peptide Sequence | Synthetic peptide located within the following region: DWHLIKEMKPPTSQEEWEAEFQRYQQFPEFKILNHDMTLTEFKFIWYMEY |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-COX15 (ARP46442_T100-HRP) antibody is Catalog # AAP46442 (Previous Catalog # AAPS18308) |
Sample Type Confirmation | COX15 is strongly supported by BioGPS gene expression data to be expressed in HepG2 |
Reference | Oquendo,C.E., (2004) J. Med. Genet. 41 (7), 540-544 |
Gene Symbol | COX15 |
---|---|
Gene Full Name | COX15 homolog, cytochrome c oxidase assembly protein (yeast) |
Alias Symbols | MC4DN6, CEMCOX2 |
NCBI Gene Id | 1355 |
Protein Name | Cytochrome c oxidase assembly protein COX15 homolog |
Description of Target | Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes a protein which is not a structural subunit, but may be essential for the biogenesis of COX formation and may function in the hydroxylation of heme O, according to the yeast mutant studies. This protein is predicted to contain 5 transmembrane domains localized in the mitochondrial inner membrane.Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes a protein which is not a structural subunit, but may be essential for the biogenesis of COX formation and may function in the hydroxylation of heme O, according to the yeast mutant studies. This protein is predicted to contain 5 transmembrane domains localized in the mitochondrial inner membrane. Alternative splicing of this gene generates several transcript variants diverging in the 3' region including alternate poly A sites. In total, 2 different isoforms are encoded by these variants. |
Uniprot ID | Q7KZN9-2 |
Protein Accession # | NP_004367 |
Nucleotide Accession # | NM_004376 |
Protein Size (# AA) | 388 |
Molecular Weight | 44kDa |
Protein Interactions | UBC; CLN3; MRPS14; NDUFA12; TOMM7; MRPL15; LAMTOR3; SURF1; NDUFS8; NDUFS6; NDUFS4; NDUFA9; CYC1; |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "COX15 Antibody - N-terminal region : HRP (ARP46442_T100-HRP)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish".
-
How long will it take to receive "COX15 Antibody - N-terminal region : HRP (ARP46442_T100-HRP)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "COX15 Antibody - N-terminal region : HRP (ARP46442_T100-HRP)" provided in?
This item is provided in "Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "COX15 Antibody - N-terminal region : HRP (ARP46442_T100-HRP)"?
This target may also be called "MC4DN6, CEMCOX2" in publications.
-
What is the shipping cost for "COX15 Antibody - N-terminal region : HRP (ARP46442_T100-HRP)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "COX15 Antibody - N-terminal region : HRP (ARP46442_T100-HRP)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "COX15 Antibody - N-terminal region : HRP (ARP46442_T100-HRP)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "44kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "COX15 Antibody - N-terminal region : HRP (ARP46442_T100-HRP)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "COX15"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "COX15"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "COX15"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "COX15"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "COX15"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "COX15"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.