SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: OAAF07328 (Formerly GWB-ASB051)
Size:100 ug
Price: $344.00
SKU
OAAF07328
Availability: Domestic: within 1-2 week delivery | International: 1-2 weeks
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for COT Antibody (Phospho-Thr290) (OAAF07328)
Product Info
Predicted Species ReactivityHuman|Mouse|Rat
ClonalityPolyclonal
HostRabbit
ApplicationEnzyme-linked immunosorbent assay|Immunocytochemistry|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin|Western blot
Additional InformationModification Sites: Human:T290 Mouse:T290 Rat:T290
Reconstitution and Storage-20°C
ImmunogenThe antiserum was produced against synthesized peptide derived from human COT around the phosphorylation site of Thr290.
PurificationThe antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.
Peptide SequenceSynthetic peptide located within the following region: PSNIVFMSTKAVLVDFGLSVQMTEDVYFPKDLRGTEIYMSPEVILCRGHS
Concentration1mg/ml
SpecificityCOT (Phospho-Thr290) Antibody detects endogenous levels of COT only when phosphorylated at Thr290.
FormulationRabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
Application InfoWB: 1:500~1:1000
IHC: 1:50~1:100
IF: 1:100~1:500
ELISA: 1:40000
Gene SymbolMAP3K8
Gene Full Namemitogen-activated protein kinase kinase kinase 8
Alias Symbolsaugmented in rheumatoid arthritis 2;AURA2;Cancer Osaka thyroid oncogene;c-COT;COT;cot (cancer Osaka thyroid) oncogene;EST;ESTF;Ewing sarcoma transformant;MEKK8;mitogen-activated protein kinase kinase kinase 8;proto-oncogene c-Cot;proto-oncogene serine/threoine protein kinase;Serine/threonine-protein kinase cot;Tpl-2;TPL2;tumor progression locus 2.
NCBI Gene Id1326
Protein NameMitogen-activated protein kinase kinase kinase 8
Description of TargetRequired for lipopolysaccharide (LPS)-induced, TLR4-mediated activation of the MAPK/ERK pathway in macrophages, thus being critical for production of the proinflammatory cytokine TNF-alpha (TNF) during immune responses. Involved in the regulation of T-helper cell differentiation and IFNG expression in T-cells. Involved in mediating host resistance to bacterial infection through negative regulation of type I interferon (IFN) production. In vitro, activates MAPK/ERK pathway in response to IL1 in an IRAK1-independent manner, leading to up-regulation of IL8 and CCL4. Transduces CD40 and TNFRSF1A signals that activate ERK in B-cells and macrophages, and thus may play a role in the regulation of immunoglobulin production. May also play a role in the transduction of TNF signals that activate JNK and NF-kappa-B in some cell types. In adipocytes, activates MAPK/ERK pathway in an IKBKB-dependent manner in response to IL1B and TNF, but not insulin, leading to induction of lipolysis. Plays a role in the cell cycle. Isoform 1 shows some transforming activity, although it is much weaker than that of the activated oncogenic variant.
Uniprot IDP41279
Molecular Weight52 kDa
  1. What is the species homology for "COT Antibody (Phospho-Thr290) (OAAF07328)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human|Mouse|Rat".

  2. How long will it take to receive "COT Antibody (Phospho-Thr290) (OAAF07328)"?

    This item is available "Domestic: within 1-2 week delivery | International: 1-2 weeks".

  3. What buffer format is "COT Antibody (Phospho-Thr290) (OAAF07328)" provided in?

    This item is provided in "".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "COT Antibody (Phospho-Thr290) (OAAF07328)"?

    This target may also be called "augmented in rheumatoid arthritis 2;AURA2;Cancer Osaka thyroid oncogene;c-COT;COT;cot (cancer Osaka thyroid) oncogene;EST;ESTF;Ewing sarcoma transformant;MEKK8;mitogen-activated protein kinase kinase kinase 8;proto-oncogene c-Cot;proto-oncogene serine/threoine protein kinase;Serine/threonine-protein kinase cot;Tpl-2;TPL2;tumor progression locus 2." in publications.

  5. What is the shipping cost for "COT Antibody (Phospho-Thr290) (OAAF07328)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "COT Antibody (Phospho-Thr290) (OAAF07328)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "COT Antibody (Phospho-Thr290) (OAAF07328)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "52 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "COT Antibody (Phospho-Thr290) (OAAF07328)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "MAP3K8"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "MAP3K8"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "MAP3K8"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "MAP3K8"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "MAP3K8"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "MAP3K8"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:COT Antibody (Phospho-Thr290) (OAAF07328)
Your Rating
We found other products you might like!