SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP38899_T100
Price: $0.00
SKU
ARP38899_T100
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-CORO1A (ARP38899_T100) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human CORO1A
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Peptide SequenceSynthetic peptide located within the following region: MSRQVVRSSKFRHVFGQPAKADQCYEDVRVSQTTWDSGFCAVNPKFVALI
Concentration1.0 mg/ml
Blocking PeptideFor anti-CORO1A (ARP38899_T100) antibody is Catalog # AAP38899 (Previous Catalog # AAPY00708)
Sample Type Confirmation

CORO1A is supported by BioGPS gene expression data to be expressed in Jurkat

ReferenceAnand,P.K. (2005) FEMS Microbiol. Lett. 250 (1), 137-144
Publications

Differential proteomic analysis of tibial subchondral bone from male and female guinea pigs with spontaneous osteoarthritis. Exp Ther Med. 21, 633 (2021) 33968164

Description
Gene SymbolCORO1A
Gene Full NameCoronin, actin binding protein, 1A
Alias Symbolsp57, IMD8, TACO, CLABP, HCORO1, CLIPINA
NCBI Gene Id11151
Protein NameCoronin-1A
Description of TargetCORO1A is a novel actin-binding protein with a WD repeat and a leucine zipper motif. CORO1A forms homodimers, that the association is mediated by the leucine zipper structure in the C-terminal region, and that it plays a role in the cross-linking of F-actin in the cell. The leukocyte plasma membrane associates with the actin cytoskeleton through CORO1A.Downregulation of CORO1A gene transcription restricts entry/survival of mycobacteria within macrophages
Uniprot IDQ2YD73
Protein Accession #NP_009005
Nucleotide Accession #NM_007074
Protein Size (# AA)461
Molecular Weight51kDa
Protein InteractionsFSD2; GOLGA2; UBC; YTHDC1; SPATA20; POT1; TAB1; GIT2; POLR1C; STAT3; SMARCD1; MAGOH; SMAD3; LMO2; FHL3; FMNL1; NCF4; THBS1; ACTB; DKK1; UBE2G2;
  1. What is the species homology for "CORO1A Antibody - N-terminal region (ARP38899_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish".

  2. How long will it take to receive "CORO1A Antibody - N-terminal region (ARP38899_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CORO1A Antibody - N-terminal region (ARP38899_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CORO1A Antibody - N-terminal region (ARP38899_T100)"?

    This target may also be called "p57, IMD8, TACO, CLABP, HCORO1, CLIPINA" in publications.

  5. What is the shipping cost for "CORO1A Antibody - N-terminal region (ARP38899_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CORO1A Antibody - N-terminal region (ARP38899_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CORO1A Antibody - N-terminal region (ARP38899_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "51kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CORO1A Antibody - N-terminal region (ARP38899_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "CORO1A"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CORO1A"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CORO1A"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CORO1A"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CORO1A"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CORO1A"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CORO1A Antibody - N-terminal region (ARP38899_T100)
Your Rating
We found other products you might like!