Catalog No: ARP47180_P050
Price: $0.00
SKU
ARP47180_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-COQ2 (ARP47180_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Dog, Goat, Horse, Pig, Rabbit, Yeast, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human COQ2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceDog: 93%; Goat: 79%; Horse: 79%; Human: 100%; Mouse: 86%; Pig: 86%; Rabbit: 93%; Rat: 86%; Yeast: 91%; Zebrafish: 86%
Peptide SequenceSynthetic peptide located within the following region: FSGVMWTLIYDTIYAHQDKRDDVLIGLKSTALRFGENTKPWLSGFSVAML
Concentration0.5 mg/ml
Blocking PeptideFor anti-COQ2 (ARP47180_P050) antibody is Catalog # AAP47180 (Previous Catalog # AAPP27952)
Sample Type Confirmation

COQ2 is supported by BioGPS gene expression data to be expressed in DU145

ReferenceBrown,M.A., (2007) J. Am. Soc. Nephrol. 18 (10), 2773-2780
Publications

New animal models reveal that coenzyme Q2 (Coq2) and placenta-specific 8 (Plac8) are candidate genes for the onset of type 2 diabetes associated with obesity in rats. Mamm. Genome. 26, 619-29 (2015). 26296322

Gene SymbolCOQ2
Gene Full NameCoenzyme Q2 homolog, prenyltransferase (yeast)
Alias SymbolsMSA1, CL640, COQ10D1, PHB:PPT
NCBI Gene Id27235
Protein Name4-hydroxybenzoate polyprenyltransferase, mitochondrial
Description of TargetCOQ2 catalyzes the prenylation of para-hydroxybenzoate (PHB) with an all-trans polyprenyl group. COQ2 mediates the second step in the final reaction sequence of coenzyme Q (CoQ) biosynthesis, which is the condensation of the polyisoprenoid side chain with PHB.CoQ (ubiquinone) serves as a redox carrier in the mitochondrial respiratory chain and is a lipid-soluble antioxidant. COQ2, or parahydroxybenzoate-polyprenyltransferase (EC 2.5.1.39), catalyzes one of the final reactions in the biosynthesis of CoQ, the prenylation of parahydroxybenzoate with an all-trans polyprenyl group (Forsgren et al., 2004 [PubMed 15153069]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-90 BC020728.1 1-90 91-96 BG699931.1 80-85 97-789 BC020728.1 97-789 790-792 BQ363759.1 169-171 793-1535 BC020728.1 793-1535 1536-1554 BC008804.2 1496-1514
Uniprot IDQ96H96
Protein Accession #NP_056512
Nucleotide Accession #NM_015697
Protein Size (# AA)384
Molecular Weight42kDa
Protein InteractionsUBC;
  1. What is the species homology for "COQ2 Antibody - middle region (ARP47180_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Dog, Goat, Horse, Pig, Rabbit, Yeast, Zebrafish".

  2. How long will it take to receive "COQ2 Antibody - middle region (ARP47180_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "COQ2 Antibody - middle region (ARP47180_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "COQ2 Antibody - middle region (ARP47180_P050)"?

    This target may also be called "MSA1, CL640, COQ10D1, PHB:PPT" in publications.

  5. What is the shipping cost for "COQ2 Antibody - middle region (ARP47180_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "COQ2 Antibody - middle region (ARP47180_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "COQ2 Antibody - middle region (ARP47180_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "42kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "COQ2 Antibody - middle region (ARP47180_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "COQ2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "COQ2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "COQ2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "COQ2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "COQ2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "COQ2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:COQ2 Antibody - middle region (ARP47180_P050)
Your Rating