Size:100 ul
Special Price $229.00 Regular Price $319.00
In Stock
SKU
ARP47180_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP47180_P050-FITC Conjugated

ARP47180_P050-HRP Conjugated

ARP47180_P050-Biotin Conjugated

COQ2 Antibody - middle region (ARP47180_P050)

Catalog#: ARP47180_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Dog, Goat, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-517107 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human COQ2
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Dog: 93%; Goat: 79%; Horse: 79%; Human: 100%; Mouse: 86%; Pig: 86%; Rabbit: 93%; Rat: 86%; Yeast: 91%; Zebrafish: 86%
Complete computational species homology data Anti-COQ2 (ARP47180_P050)
Peptide Sequence Synthetic peptide located within the following region: FSGVMWTLIYDTIYAHQDKRDDVLIGLKSTALRFGENTKPWLSGFSVAML
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-COQ2 (ARP47180_P050) antibody is Catalog # AAP47180 (Previous Catalog # AAPP27952)
Datasheets/Manuals Printable datasheet for anti-COQ2 (ARP47180_P050) antibody
Sample Type Confirmation

COQ2 is supported by BioGPS gene expression data to be expressed in DU145

Target Reference Brown,M.A., (2007) J. Am. Soc. Nephrol. 18 (10), 2773-2780
Publications

Sasaki, D; Kotoh, J; Watadani, R; Matsumoto, K; New animal models reveal that coenzyme Q2 (Coq2) and placenta-specific 8 (Plac8) are candidate genes for the onset of type 2 diabetes associated with obesity in rats. 26, 619-29 (2015). WB, Dog, Goat, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast, Zebrafish 26296322

Gene Symbol COQ2
Official Gene Full Name Coenzyme Q2 homolog, prenyltransferase (yeast)
Alias Symbols CL640, FLJ26072
NCBI Gene Id 27235
Protein Name 4-hydroxybenzoate polyprenyltransferase, mitochondrial
Description of Target COQ2 catalyzes the prenylation of para-hydroxybenzoate (PHB) with an all-trans polyprenyl group. COQ2 mediates the second step in the final reaction sequence of coenzyme Q (CoQ) biosynthesis, which is the condensation of the polyisoprenoid side chain with PHB.CoQ (ubiquinone) serves as a redox carrier in the mitochondrial respiratory chain and is a lipid-soluble antioxidant. COQ2, or parahydroxybenzoate-polyprenyltransferase (EC 2.5.1.39), catalyzes one of the final reactions in the biosynthesis of CoQ, the prenylation of parahydroxybenzoate with an all-trans polyprenyl group (Forsgren et al., 2004 [PubMed 15153069]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-90 BC020728.1 1-90 91-96 BG699931.1 80-85 97-789 BC020728.1 97-789 790-792 BQ363759.1 169-171 793-1535 BC020728.1 793-1535 1536-1554 BC008804.2 1496-1514
Swissprot Id Q96H96
Protein Accession # NP_056512
Nucleotide Accession # NM_015697
Protein Size (# AA) 384
Molecular Weight 42kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express COQ2.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express COQ2.
Protein Interactions UBC;
  1. What is the species homology for "COQ2 Antibody - middle region (ARP47180_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Dog, Goat, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast, Zebrafish".

  2. How long will it take to receive "COQ2 Antibody - middle region (ARP47180_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "COQ2 Antibody - middle region (ARP47180_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "COQ2 Antibody - middle region (ARP47180_P050)"?

    This target may also be called "CL640, FLJ26072" in publications.

  5. What is the shipping cost for "COQ2 Antibody - middle region (ARP47180_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "COQ2 Antibody - middle region (ARP47180_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "COQ2 Antibody - middle region (ARP47180_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "42kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "COQ2 Antibody - middle region (ARP47180_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "COQ2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "COQ2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "COQ2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "COQ2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "COQ2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "COQ2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:COQ2 Antibody - middle region (ARP47180_P050)
Your Rating