Search Antibody, Protein, and ELISA Kit Solutions

COQ2 antibody - middle region (ARP47180_P050)

100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP47180_P050-FITC Conjugated

ARP47180_P050-HRP Conjugated

ARP47180_P050-Biotin Conjugated

Gene Symbol:
COQ2
NCBI Gene Id:
27235
Official Gene Full Name:
Coenzyme Q2 homolog, prenyltransferase (yeast)
Protein Name:
4-hydroxybenzoate polyprenyltransferase, mitochondrial
Swissprot Id:
Q96H96
Protein Accession #:
NP_056512
Nucleotide Accession #:
NM_015697
Alias Symbols:
CL640, FLJ26072
Replacement Item:
This antibody may replace item sc-517107 from Santa Cruz Biotechnology.
Description of Target:
COQ2 catalyzes the prenylation of para-hydroxybenzoate (PHB) with an all-trans polyprenyl group. COQ2 mediates the second step in the final reaction sequence of coenzyme Q (CoQ) biosynthesis, which is the condensation of the polyisoprenoid side chain with PHB.CoQ (ubiquinone) serves as a redox carrier in the mitochondrial respiratory chain and is a lipid-soluble antioxidant. COQ2, or parahydroxybenzoate-polyprenyltransferase (EC 2.5.1.39), catalyzes one of the final reactions in the biosynthesis of CoQ, the prenylation of parahydroxybenzoate with an all-trans polyprenyl group (Forsgren et al., 2004 [PubMed 15153069]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-90 BC020728.1 1-90 91-96 BG699931.1 80-85 97-789 BC020728.1 97-789 790-792 BQ363759.1 169-171 793-1535 BC020728.1 793-1535 1536-1554 BC008804.2 1496-1514
Protein Size (# AA):
384
Molecular Weight:
42kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express COQ2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express COQ2.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human COQ2
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Dog: 93%; Goat: 79%; Horse: 79%; Human: 100%; Mouse: 86%; Pig: 86%; Rabbit: 93%; Rat: 86%; Yeast: 91%; Zebrafish: 86%
Complete computational species homology data:
Anti-COQ2 (ARP47180_P050)
Peptide Sequence:
Synthetic peptide located within the following region: FSGVMWTLIYDTIYAHQDKRDDVLIGLKSTALRFGENTKPWLSGFSVAML
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC;
Blocking Peptide:
For anti-COQ2 (ARP47180_P050) antibody is Catalog # AAP47180 (Previous Catalog # AAPP27952)
Datasheets/Manuals:
Printable datasheet for anti-COQ2 (ARP47180_P050) antibody
Sample Type Confirmation:

COQ2 is supported by BioGPS gene expression data to be expressed in DU145

Target Reference:
Brown,M.A., (2007) J. Am. Soc. Nephrol. 18 (10), 2773-2780
Publications:

Sasaki, D; Kotoh, J; Watadani, R; Matsumoto, K; New animal models reveal that coenzyme Q2 (Coq2) and placenta-specific 8 (Plac8) are candidate genes for the onset of type 2 diabetes associated with obesity in rats. 26, 619-29 (2015). WB, Dog, Goat, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast, Zebrafish 26296322

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...