Search Antibody, Protein, and ELISA Kit Solutions

COPS8 Antibody - middle region (ARP52242_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP52242_P050-FITC Conjugated

ARP52242_P050-HRP Conjugated

ARP52242_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
COP9 constitutive photomorphogenic homolog subunit 8 (Arabidopsis)
NCBI Gene Id:
Protein Name:
COP9 signalosome complex subunit 8
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
COP9, CSN8, MGC1297, MGC43256, SGN8
Replacement Item:
This antibody may replace item sc-119487 from Santa Cruz Biotechnology.
Description of Target:
The protein encoded by this gene is one of the eight subunits of COP9 signalosome, a highly conserved protein complex that functions as an important regulator in multiple signaling pathways. The structure and function of COP9 signalosome is similar to that of the 19S regulatory particle of 26S proteasome. COP9 signalosome has been shown to interact with SCF-type E3 ubiquitin ligases and act as a positive regulator of E3 ubiquitin ligases. Alternatively spliced transcript variants encoding distinct isoforms have been observed.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express COPS8.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express COPS8.
The immunogen is a synthetic peptide directed towards the middle region of human COPS8
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-COPS8 (ARP52242_P050)
Peptide Sequence:
Synthetic peptide located within the following region: TRMVLPRKPVAGALDVSFNKFIPLSEPAPVPPIPNEQQLARLTDYVAFLE
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-COPS8 (ARP52242_P050) antibody is Catalog # AAP52242 (Previous Catalog # AAPP44002)
Printable datasheet for anti-COPS8 (ARP52242_P050) antibody
Sample Type Confirmation:

There is BioGPS gene expression data showing that COPS8 is expressed in HepG2


Pick, E. et al. The minimal deneddylase core of the COP9 signalosome excludes the Csn6 MPN- domain. PLoS One 7, e43980 (2012). WB, IHC, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 22956996

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...