Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
SKU
ARP52242_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP52242_P050-FITC Conjugated

ARP52242_P050-HRP Conjugated

ARP52242_P050-Biotin Conjugated

COPS8 Antibody - middle region (ARP52242_P050)

Catalog#: ARP52242_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB, IHC
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-119487 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human COPS8
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data Anti-COPS8 (ARP52242_P050)
Peptide Sequence Synthetic peptide located within the following region: TRMVLPRKPVAGALDVSFNKFIPLSEPAPVPPIPNEQQLARLTDYVAFLE
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-COPS8 (ARP52242_P050) antibody is Catalog # AAP52242 (Previous Catalog # AAPP44002)
Datasheets/Manuals Printable datasheet for anti-COPS8 (ARP52242_P050) antibody
Sample Type Confirmation

There is BioGPS gene expression data showing that COPS8 is expressed in HepG2

Subunit 8
Publications

Pick, E. et al. The minimal deneddylase core of the COP9 signalosome excludes the Csn6 MPN- domain. PLoS One 7, e43980 (2012). WB, IHC, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 22956996

Gene Symbol COPS8
Official Gene Full Name COP9 constitutive photomorphogenic homolog subunit 8 (Arabidopsis)
Alias Symbols COP9, CSN8, MGC1297, MGC43256, SGN8
NCBI Gene Id 10920
Protein Name COP9 signalosome complex subunit 8
Description of Target The protein encoded by this gene is one of the eight subunits of COP9 signalosome, a highly conserved protein complex that functions as an important regulator in multiple signaling pathways. The structure and function of COP9 signalosome is similar to that of the 19S regulatory particle of 26S proteasome. COP9 signalosome has been shown to interact with SCF-type E3 ubiquitin ligases and act as a positive regulator of E3 ubiquitin ligases. Alternatively spliced transcript variants encoding distinct isoforms have been observed.
Swissprot Id Q99627
Protein Accession # NP_006701
Nucleotide Accession # NM_006710
Protein Size (# AA) 209
Molecular Weight 23kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express COPS8.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express COPS8.
Protein Interactions USHBP1; GPS1; cul1; WDR77; SRRT; COPS7A; VIM; COPS4; FBXO6; FBXW4; COPS5; vpr; IRF5; DDIT3; COPS2; COPS3; COPS6; PINK1; RFWD2; CUL4A; UBC; LRR1; DDA1; DDB2; DCUN1D1; VPRBP; CUL2; CUL3; CUL4B; CUL5; NEDD8; JUN; GFER; ERCC8; DDB1; CTNNB1; RAE1; COPS8; EIF3E
Write Your Own Review
You're reviewing:COPS8 Antibody - middle region (ARP52242_P050)
Your Rating