Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
SKU
ARP59350_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP59350_P050-FITC Conjugated

ARP59350_P050-HRP Conjugated

ARP59350_P050-Biotin Conjugated

COPS6 Antibody - middle region (ARP59350_P050)

Catalog#: ARP59350_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-47965 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human COPS6
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Complete computational species homology dataAnti-COPS6 (ARP59350_P050)
Peptide SequenceSynthetic peptide located within the following region: DHVARMTATGSGENSTVAEHLIAQHSAIKMLHSRVKLILEYVKASEAGEV
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-COPS6 (ARP59350_P050) antibody is Catalog # AAP59350 (Previous Catalog # AAPP45447)
Datasheets/ManualsPrintable datasheet for anti-COPS6 (ARP59350_P050) antibody
Sample Type Confirmation

COPS6 is strongly supported by BioGPS gene expression data to be expressed in 721_B

Subunit6
Publications

Pick, E. et al. The minimal deneddylase core of the COP9 signalosome excludes the Csn6 MPN- domain. PLoS One 7, e43980 (2012). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 22956996

Gene SymbolCOPS6
Official Gene Full NameCOP9 constitutive photomorphogenic homolog subunit 6 (Arabidopsis)
Alias SymbolsCSN6, MOV34-34KD
NCBI Gene Id10980
Protein NameCOP9 signalosome complex subunit 6
Description of TargetThe protein encoded by this gene is one of the eight subunits of COP9 signalosome, a highly conserved protein complex that functions as an important regulator in multiple signaling pathways. The structure and function of COP9 signalosome is similar to that of the 19S regulatory particle of 26S proteasome. COP9 signalosome has been shown to interact with SCF-type E3 ubiquitin ligases and act as a positive regulator of E3 ubiquitin ligases. This protein belongs to translation initiation factor 3 (eIF3) superfamily. It is involved in the regulation of cell cycle and likely to be a cellular cofactor for HIV-1 accessory gene product Vpr.
Swissprot IdQ7L5N1
Protein Accession #NP_006824
Nucleotide Accession #NM_006833
Protein Size (# AA)327
Molecular Weight36kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express COPS6.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express COPS6.
Protein InteractionsNEDD8; CUL1; UBC; COPS5; GPS1; SUMO1; POP7; COPS7B; COPS7A; CUL4B; USP7; COPS4; FBXO6; FBXW4; IGHV3OR15-7; vpr; TP63; RFWD2; SFN; IRF5; COPS8; COPS2; COPS3; DDB2; DDB1; ERCC8; TOR1AIP2; LRR1; RBX1; VPRBP; LRRC14; CUL2; CUL3; CUL4A; CUL5; TCEB2; TCEB1; SKP
Write Your Own Review
You're reviewing:COPS6 Antibody - middle region (ARP59350_P050)
Your Rating
Aviva ChIP Antibodies
Aviva Tissue Tool
Aviva Live Chat
Aviva Validation Data