Search Antibody, Protein, and ELISA Kit Solutions

COPS5 Antibody - N-terminal region (ARP31512_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP31512_P050-FITC Conjugated

ARP31512_P050-HRP Conjugated

ARP31512_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
COP9 constitutive photomorphogenic homolog subunit 5 (Arabidopsis)
NCBI Gene Id:
Protein Name:
COP9 signalosome complex subunit 5
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
CSN5, JAB1, MGC3149, MOV-34, SGN5
Replacement Item:
This antibody may replace item sc-13157 from Santa Cruz Biotechnology.
Description of Target:
COPS5 is one of the eight subunits of COP9 signalosome, a highly conserved protein complex that functions as an important regulator in multiple signaling pathways. The structure and function of COP9 signalosome is similar to that of the 19S regulatory particle of 26S proteasome. COP9 signalosome has been shown to interact with SCF-type E3 ubiquitin ligases and act as a positive regulator of E3 ubiquitin ligases. This protein is reported to be involved in the degradation of cyclin-dependent kinase inhibitor CDKN1B/p27Kip1. It is also known to be an coactivator that increases the specificity of JUN/AP1 transcription factors. The protein encoded by this gene is one of the eight subunits of COP9 signalosome, a highly conserved protein complex that functions as an important regulator in multiple signaling pathways. The structure and function of COP9 signalosome is similar to that of the 19S regulatory particle of 26S proteasome. COP9 signalosome has been shown to interact with SCF-type E3 ubiquitin ligases and act as a positive regulator of E3 ubiquitin ligases. This protein is reported to be involved in the degradation of cyclin-dependent kinase inhibitor CDKN1B/p27Kip1. It is also known to be an coactivator that increases the specificity of JUN/AP1 transcription factors. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express COPS5.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express COPS5.
The immunogen is a synthetic peptide directed towards the N terminal region of human COPS5
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Complete computational species homology data:
Anti-COPS5 (ARP31512_P050)
Peptide Sequence:
Synthetic peptide located within the following region: AASGSGMAQKTWELANNMQEAQSIDEIYKYDKKQQQEILAAKPWTKDHHY
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-COPS5 (ARP31512_P050) antibody is Catalog # AAP31512 (Previous Catalog # AAPP02274)
Printable datasheet for anti-COPS5 (ARP31512_P050) antibody
Target Reference:
Zhang,X.C., (2008) J. Cell. Biochem. 103 (4), 1219-1230

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...