COPS4 Antibody - middle region (ARP56841_P050)

Catalog No: ARP56841_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

WB Suggested Anti-COPS4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human COPS4
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
• Peptide Sequence: Synthetic peptide located within the following region: YKLETYLKIARLYLEDDDPVQAEAYINRASLLQNESTNEQLQIHYKVCYA
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-COPS4 (ARP56841_P050) antibody is Catalog # AAP56841 (Previous Catalog # AAPP35428)
• Subunit: 4

Target Info

• Reference: Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)
• Gene Symbol: COPS4
• Gene Full Name: COP9 constitutive photomorphogenic homolog subunit 4 (Arabidopsis)
• Alias Symbols: CSN4, SGN4
• NCBI Gene Id: 51138
• Protein Name: COP9 signalosome complex subunit 4
• Description of Target: COPS4 is one of eight subunits composing COP9 signalosome, a highly conserved protein complex that functions as an important regulator in multiple signaling pathways. The structure and function of COP9 signalosome is similar to that of the 19S regulatory particle of 26S proteasome. COP9 signalosome has been shown to interact with SCF-type E3 ubiquitin ligases and act as a positive regulator of E3 ubiquitin ligases.This gene encodes one of eight subunits composing COP9 signalosome, a highly conserved protein complex that functions as an important regulator in multiple signaling pathways. The structure and function of COP9 signalosome is similar to that of the 19S regulatory particle of 26S proteasome. COP9 signalosome has been shown to interact with SCF-type E3 ubiquitin ligases and act as a positive regulator of E3 ubiquitin ligases. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Uniprot ID: Q9BT78
• Protein Accession #: NP_057213
• Nucleotide Accession #: NM_016129
• Protein Size (# AA): 406
• Molecular Weight: 46kDa
• Protein Interactions: USHBP1; GPS1; UBC; Skp2; PRMT5; KPNA2; HSP90AB1; EPB41L2; EPB41L1; CAST; WDR77; ENAH; DCAF8; COPS5; STIP1; COPS6; YWHAQ; FOS; COPS8; COPS7A; FBXO6; BAG3; FBXW4; vpr; IRF5; COPS7B; COPS2; COPS3; TOR1AIP2; LRR1; FBXO17; DCAF11; DDA1; RFWD2; KLHL42; GRK5; DD