SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP56841_P050
Price: $0.00
SKU
ARP56841_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

COPS4 Antibody - middle region (ARP56841_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-COPS4 (ARP56841_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human COPS4
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Peptide SequenceSynthetic peptide located within the following region: YKLETYLKIARLYLEDDDPVQAEAYINRASLLQNESTNEQLQIHYKVCYA
Concentration0.5 mg/ml
Blocking PeptideFor anti-COPS4 (ARP56841_P050) antibody is Catalog # AAP56841 (Previous Catalog # AAPP35428)
Subunit4
ReferenceEwing,R.M., Mol. Syst. Biol. 3, 89 (2007)
Gene SymbolCOPS4
Gene Full NameCOP9 constitutive photomorphogenic homolog subunit 4 (Arabidopsis)
Alias SymbolsCSN4, SGN4
NCBI Gene Id51138
Protein NameCOP9 signalosome complex subunit 4
Description of TargetCOPS4 is one of eight subunits composing COP9 signalosome, a highly conserved protein complex that functions as an important regulator in multiple signaling pathways. The structure and function of COP9 signalosome is similar to that of the 19S regulatory particle of 26S proteasome. COP9 signalosome has been shown to interact with SCF-type E3 ubiquitin ligases and act as a positive regulator of E3 ubiquitin ligases.This gene encodes one of eight subunits composing COP9 signalosome, a highly conserved protein complex that functions as an important regulator in multiple signaling pathways. The structure and function of COP9 signalosome is similar to that of the 19S regulatory particle of 26S proteasome. COP9 signalosome has been shown to interact with SCF-type E3 ubiquitin ligases and act as a positive regulator of E3 ubiquitin ligases. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Uniprot IDQ9BT78
Protein Accession #NP_057213
Nucleotide Accession #NM_016129
Protein Size (# AA)406
Molecular Weight46kDa
Protein InteractionsUSHBP1; GPS1; UBC; Skp2; PRMT5; KPNA2; HSP90AB1; EPB41L2; EPB41L1; CAST; WDR77; ENAH; DCAF8; COPS5; STIP1; COPS6; YWHAQ; FOS; COPS8; COPS7A; FBXO6; BAG3; FBXW4; vpr; IRF5; COPS7B; COPS2; COPS3; TOR1AIP2; LRR1; FBXO17; DCAF11; DDA1; RFWD2; KLHL42; GRK5; DD
  1. What is the species homology for "COPS4 Antibody - middle region (ARP56841_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish".

  2. How long will it take to receive "COPS4 Antibody - middle region (ARP56841_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "COPS4 Antibody - middle region (ARP56841_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "COPS4 Antibody - middle region (ARP56841_P050)"?

    This target may also be called "CSN4, SGN4" in publications.

  5. What is the shipping cost for "COPS4 Antibody - middle region (ARP56841_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "COPS4 Antibody - middle region (ARP56841_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "COPS4 Antibody - middle region (ARP56841_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "46kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "COPS4 Antibody - middle region (ARP56841_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "COPS4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "COPS4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "COPS4"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "COPS4"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "COPS4"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "COPS4"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:COPS4 Antibody - middle region (ARP56841_P050)
Your Rating
We found other products you might like!