Cops3 Antibody - C-terminal region (ARP59348_P050)

Catalog No: ARP59348_P050

Host: Rabbit
Target Name: Cops3
Sample Type: Rat Testis lysates
Antibody Dilution: 1.0ug/ml

Product Info

• Tested Species Reactivity: Rat
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Cops3
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
• Peptide Sequence: Synthetic peptide located within the following region: NIQRLTKTFLTLSLQDMASRVQLSGPQEAEKYVLHMIEDGEIFASINQKD
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-Cops3 (ARP59348_P050) antibody is Catalog # AAP59348

Target Info

• Gene Symbol: Cops3
• Gene Full Name: COP9 constitutive photomorphogenic homolog subunit 3 (Arabidopsis)
• Alias Symbols: -
• NCBI Gene Id: 287367
• Protein Name: COP9 signalosome complex subunit 3
• Description of Target: Cops3 is a subunit of the COP9 signalosome complex; mouse homolog plays a role in early embryonic development.
• Uniprot ID: Q68FW9
• Protein Accession #: NP_001004200
• Nucleotide Accession #: NM_001004200
• Protein Size (# AA): 423
• Molecular Weight: 46kDa
• Protein Interactions: Ubc;