COPS2 Antibody - N-terminal region : HRP (ARP34188_P050-HRP)

Catalog No: ARP34188_P050-HRP

Size:100ul

Click here to learn more about Aviva's By-Request Conjugation Service.

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
• Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: HRP: Horseradish Peroxidase
• Application: WB, IHC
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human COPS2
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 85%; Zebrafish: 100%
• Peptide Sequence: Synthetic peptide located within the following region: SDMEDDFMCDDEEDYDLEYSEDSNSEPNVDLENQYYNSKALKEDDPKAAL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-COPS2 (ARP34188_P050-HRP) antibody is Catalog # AAP34188 (Previous Catalog # AAPP05503)
• Subunit: 2
• Reference: Leal,J.F., (2008) Oncogene 27 (14), 1961-1970

Target Info

• Gene Symbol: COPS2
• Gene Full Name: COP9 constitutive photomorphogenic homolog subunit 2 (Arabidopsis)
• Alias Symbols: CSN2, SGN2, ALIEN, TRIP15
• NCBI Gene Id: 9318
• Protein Name: COP9 signalosome complex subunit 2
• Description of Target: COPS2 is an essential component of the COP9 signalosome complex (CSN). The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF-type complexes such as SCF, CSA or DDB2. The complex is also involved in phosphorylation of p53/TP53, c-jun/JUN, IkappaBalpha/NFKBIA, ITPK1 and IRF8/ICSBP, possibly via its association with CK2 and PKD kinases. CSN-dependent phosphorylation of TP53 and JUN promotes and protects degradation by the Ubl system, respectively. COPS2 is involved in early stage of neuronal differentiation via its interaction with NIF3L1.
• Uniprot ID: P61201
• Protein Accession #: NP_004227
• Nucleotide Accession #: NM_004236
• Protein Size (# AA): 443
• Molecular Weight: 52kDa
• Protein Interactions: UBC; GPS1; Map3k10; 5830415F09Rik; Taf1b; EP300; Crebbp; cul1; COPS7B; EPB41L1; COPS5; FBXW4; SENP8; vpr; IRF5; COPS4; COPS7A; COPS6; COPS8; COPS3; PMPCA; SEPHS1; EHBP1L1; SLAIN2; GAPVD1; PFKFB2; SEPT2; IRS2; GRK5; DDB2; LRR1; DCAF11; DDA1; RFWD2; DCAF8;