- Gene Symbol:
- COPS2
- NCBI Gene Id:
- 9318
- Official Gene Full Name:
- COP9 constitutive photomorphogenic homolog subunit 2 (Arabidopsis)
- Protein Name:
- COP9 signalosome complex subunit 2
- Swissprot Id:
- P61203
- Protein Accession #:
- NP_004227
- Nucleotide Accession #:
- NM_004236
- Alias Symbols:
- ALIEN, CSN2, SGN2, TRIP15
- Description of Target:
- COPS2 is an essential component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of SCF-type E3 ligase complexes. The complex is also involved in phosphorylation of p53/TP53, c-jun/JUN, IkappaBalpha/NFKBIA, ITPK1 and IRF8/ICSBP. COPS2 is also innvolved in early stage of neuronal differentiation via its interaction with NIF3L1.
- Protein Size (# AA):
- 443
- Molecular Weight:
- 51kDa
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Purification:
- Protein A purified
- Application:
- IHC, WB
- Tissue Tool:
- Find tissues and cell lines supported by DNA array analysis to express COPS2.
- RNA Seq:
- Find tissues and cell lines supported by RNA-seq analysis to express COPS2.
- Immunogen:
- The immunogen is a synthetic peptide directed towards the N terminal region of human COPS2
- Tested Species Reactivity:
- Human
- Predicted Homology Based on Immunogen Sequence:
- Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
- Complete computational species homology data:
- Anti-COPS2 (ARP38431_T100)
- Peptide Sequence:
- Synthetic peptide located within the following region: MSDMEDDFMCDDEEDYDLEYSEDSNSEPNVDLENQYYNSKALKEDDPKAA
- Product Format:
- Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
- Reconstitution and Storage:
- For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
- Concentration:
- Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
- Protein Interactions:
- UBC; GPS1; Map3k10; 5830415F09Rik; Taf1b; EP300; Crebbp; cul1; COPS7B; EPB41L1; COPS5; FBXW4; SENP8; vpr; IRF5; COPS4; COPS7A; COPS6; COPS8; COPS3; PMPCA; SEPHS1; EHBP1L1; SLAIN2; GAPVD1; PFKFB2; SEPT2; IRS2; GRK5; DDB2; LRR1; DCAF11; DDA1; RFWD2; DCAF8;
- Blocking Peptide:
- For anti-COPS2 (ARP38431_T100) antibody is Catalog # AAP38431 (Previous Catalog # AAPP20620)
- Datasheets/Manuals:
- Printable datasheet for anti-COPS2 (ARP38431_T100) antibody
- Sample Type Confirmation:
COPS2 is strongly supported by BioGPS gene expression data to be expressed in HEK293T
- Subunit:
- 2
- Additional Information:
- IHC Information: Transfected 293T cell lysate. Antibody concentration: 2.5 ug/ml. Gel concentration: 12%.
- Target Reference:
- Moehren,U., (2004) (er) Nucleic Acids Res. 32 (10), 2995-3004
- Publications:
Pick, E. et al. The minimal deneddylase core of the COP9 signalosome excludes the Csn6 MPN- domain. PLoS One 7, e43980 (2012). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 22956996
Product Reviews
- Protocol:
- Tips Information:
See our General FAQ page.
