COPS2 Antibody - N-terminal region (ARP38431_T100)

Catalog No: ARP38431_T100

Click here to learn more about Aviva's By-Request Conjugation Service.

WB Suggested Antibody Titration: 2.5 ug/ml
Positive Control: 293TCOPS2 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells

Human Skin

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Additional Information: IHC Information: Transfected 293T cell lysate. Antibody concentration: 2.5 ug/ml. Gel concentration: 12%.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human COPS2
• Purification: Protein A purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
• Peptide Sequence: Synthetic peptide located within the following region: MSDMEDDFMCDDEEDYDLEYSEDSNSEPNVDLENQYYNSKALKEDDPKAA
• Concentration: 1.0 mg/ml
• Blocking Peptide: For anti-COPS2 (ARP38431_T100) antibody is Catalog # AAP38431 (Previous Catalog # AAPP20620)
• Sample Type Confirmation:

  COPS2 is strongly supported by BioGPS gene expression data to be expressed in HEK293T

• Subunit: 2
• Reference: Moehren,U., (2004) (er) Nucleic Acids Res. 32 (10), 2995-3004
• Publications:

  Pick, E. et al. The minimal deneddylase core of the COP9 signalosome excludes the Csn6 MPN- domain. PLoS One 7, e43980 (2012). 22956996

Target Info

• Gene Symbol: COPS2
• Gene Full Name: COP9 constitutive photomorphogenic homolog subunit 2 (Arabidopsis)
• Alias Symbols: CSN2, SGN2, ALIEN, TRIP15
• NCBI Gene Id: 9318
• Protein Name: COP9 signalosome complex subunit 2
• Description of Target: COPS2 is an essential component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of SCF-type E3 ligase complexes. The complex is also involved in phosphorylation of p53/TP53, c-jun/JUN, IkappaBalpha/NFKBIA, ITPK1 and IRF8/ICSBP. COPS2 is also innvolved in early stage of neuronal differentiation via its interaction with NIF3L1.
• Uniprot ID: P61203
• Protein Accession #: NP_004227
• Nucleotide Accession #: NM_004236
• Protein Size (# AA): 443
• Molecular Weight: 51kDa
• Protein Interactions: UBC; GPS1; Map3k10; 5830415F09Rik; Taf1b; EP300; Crebbp; cul1; COPS7B; EPB41L1; COPS5; FBXW4; SENP8; vpr; IRF5; COPS4; COPS7A; COPS6; COPS8; COPS3; PMPCA; SEPHS1; EHBP1L1; SLAIN2; GAPVD1; PFKFB2; SEPT2; IRS2; GRK5; DDB2; LRR1; DCAF11; DDA1; RFWD2; DCAF8;