Search Antibody, Protein, and ELISA Kit Solutions

COPS2 Antibody - N-terminal region (ARP34188_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP34188_P050-FITC Conjugated

ARP34188_P050-HRP Conjugated

ARP34188_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
COPS2
Official Gene Full Name:
COP9 constitutive photomorphogenic homolog subunit 2 (Arabidopsis)
NCBI Gene Id:
9318
Protein Name:
COP9 signalosome complex subunit 2
Swissprot Id:
P61201
Protein Accession #:
NP_004227
Nucleotide Accession #:
NM_004236
Alias Symbols:
ALIEN, CSN2, SGN2, TRIP15
Description of Target:
COPS2 is an essential component of the COP9 signalosome complex (CSN). The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF-type complexes such as SCF, CSA or DDB2. The complex is also involved in phosphorylation of p53/TP53, c-jun/JUN, IkappaBalpha/NFKBIA, ITPK1 and IRF8/ICSBP, possibly via its association with CK2 and PKD kinases. CSN-dependent phosphorylation of TP53 and JUN promotes and protects degradation by the Ubl system, respectively. COPS2 is involved in early stage of neuronal differentiation via its interaction with NIF3L1.
Protein Size (# AA):
443
Molecular Weight:
52kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB, IHC
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express COPS2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express COPS2.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human COPS2
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 85%; Zebrafish: 100%
Complete computational species homology data:
Anti-COPS2 (ARP34188_P050)
Peptide Sequence:
Synthetic peptide located within the following region: SDMEDDFMCDDEEDYDLEYSEDSNSEPNVDLENQYYNSKALKEDDPKAAL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; GPS1; Map3k10; 5830415F09Rik; Taf1b; EP300; Crebbp; cul1; COPS7B; EPB41L1; COPS5; FBXW4; SENP8; vpr; IRF5; COPS4; COPS7A; COPS6; COPS8; COPS3; PMPCA; SEPHS1; EHBP1L1; SLAIN2; GAPVD1; PFKFB2; SEPT2; IRS2; GRK5; DDB2; LRR1; DCAF11; DDA1; RFWD2; DCAF8;
Blocking Peptide:
For anti-COPS2 (ARP34188_P050) antibody is Catalog # AAP34188 (Previous Catalog # AAPP05503)
Datasheets/Manuals:
Printable datasheet for anti-COPS2 (ARP34188_P050) antibody
Subunit:
2
Target Reference:
Leal,J.F., (2008) Oncogene 27 (14), 1961-1970

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...