Aviva Systems Biology will be closed in observance of Good Friday 3/29/2024. If you are in need of any assistance please email info@avivasysbio.com

Catalog No: OPCA04044
Price: $0.00
SKU
OPCA04044
Availability: Domestic: within 4-6 weeks delivery | International: 4-6 weeks
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

COMT Recombinant Protein (Human) (OPCA04044)

Datasheets/ManualsPrintable datasheet for OPCA04044
Product Info
Predicted Species ReactivityHuman
Product FormatLiquid
Additional InformationSpecies Specificity Detail: Homo sapiens (Human)
Reconstitution and StorageBriefly centrifuge lyophilized product prior to opening to bring the contents to the bottom. Please reconstitute protein to 0.1-1.0 mg/mL by adding deionized sterile water first, followed by addition of glycerol to a final concentration of 5-50%. Reconstituted product should be aliquoted for long-term storage at -20C/-80C. Our in house default final concentration of glycerol is 50% for reference. The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
FormulationTris-base, 50% glycerol
PurityGreater than 90% as determined by SDS-PAGE.
Protein SequencePartial: GDTKEQRILNHVLQHAEPGNAQSVLEAIDTYCEQKEWAMNVGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFECTHYQSFLEYREVVDGLEKAIYKGPGSEAGP
Storage BufferTris-base, 50% glycerol
SourceE.coli
TagN-terminal 6xHis-tagged
ReferenceCloning and characterization of human placental catechol-O-methyltransferase cDNA.Lundstroem K., Salminen M., Jalanko A., Savolainen R., Ulmanen I.DNA Cell Biol. 10:181-189(1991)
Gene SymbolCOMT
Gene Full Namecatechol-O-methyltransferase
Alias SymbolsHEL-S-98n
NCBI Gene Id1312
Protein NameCatechol O-methyltransferase
Description of TargetCatalyzes the O-methylation, and thereby the inactivation, of catecholamine neurotransmitters and catechol hormones. Also shortens the biological half-lives of certain neuroactive drugs, like L-DOPA, alpha-methyl DOPA and isoproterenol.
Uniprot IDP21964
Protein Accession #NP_000745
Nucleotide Accession #NM_000754
Molecular Weight28 kDa
Write Your Own Review
You're reviewing:COMT Recombinant Protein (Human) (OPCA04044)
Your Rating
We found other products you might like!