Search Antibody, Protein, and ELISA Kit Solutions

COLEC11 Antibody - C-terminal region : FITC (ARP73799_P050-FITC)

100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP73799_P050 Unconjugated

ARP73799_P050-HRP Conjugated

ARP73799_P050-Biotin Conjugated

Gene Symbol:
COLEC11
NCBI Gene Id:
78989
Swissprot Id:
Q9BWP8
Alias Symbols:
COLEC11, UNQ596/PRO1182,
Replacement Item:
This antibody may replace item sc-242495 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes a member of the collectin family of C-type lectins that possess collagen-like sequences and carbohydrate recognition domains. Collectins are secreted proteins that play important roles in the innate immune system by binding to carbohydrate antigens on microorganisms, facilitating their recognition and removal. The encoded protein binds to multiple sugars with a preference for fucose and mannose. Mutations in this gene are a cause of 3MC syndrome-2. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Protein Size (# AA):
271
Molecular Weight:
29kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express COLEC11.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express COLEC11.
Immunogen:
The immunogen is a synthetic peptide directed towards the C-terminal region of Human COLEC11
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: AQAGLARVFIGINDLEKEGAFVYSDHSPMRTFNKWRSGEPNNAYDEEDCV
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Blocking Peptide:
For anti-COLEC11 (ARP73799_P050-FITC) antibody is Catalog # AAP73799
Datasheets/Manuals:
Printable datasheet for anti-COLEC11 (ARP73799_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...