COL4A3BP Antibody - N-terminal region : HRP (ARP52418_P050-HRP)

Catalog No: ARP52418_P050-HRP

Size:100ul

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: HRP: Horseradish Peroxidase
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human COL4A3BP
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 92%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%
• Peptide Sequence: Synthetic peptide located within the following region: PPVERCGVLSKWTNYIHGWQDRWVVLKNNALSYYKSEDETEYGCRGSICL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-COL4A3BP (ARP52418_P050-HRP) antibody is Catalog # AAP52418 (Previous Catalog # AAPS31705)

Target Info

• Reference: Saito,S., (2008) J. Biol. Chem. 283 (10), 6584-6593
• Gene Symbol: COL4A3BP
• Gene Full Name: Collagen, type IV, alpha 3 (Goodpasture antigen) binding protein
• Alias Symbols: CERT, GPBP, CERTL, MRD34, STARD11, COL4A3BP
• NCBI Gene Id: 10087
• Protein Name: Collagen type IV alpha-3-binding protein
• Description of Target: COL4A3BP is a kinase that specifically phosphorylates the N-terminal region of the non-collagenous domain of the alpha 3 chain of type IV collagen, known as the Goodpasture antigen. Goodpasture disease is the result of an autoimmune response directed at this antigen. One isoform of this protein is also involved in ceramide intracellular transport.This gene encodes a kinase that specifically phosphorylates the N-terminal region of the non-collagenous domain of the alpha 3 chain of type IV collagen, known as the Goodpasture antigen. Goodpasture disease is the result of an autoimmune response directed at this antigen. One isoform of this protein is also involved in ceramide intracellular transport. Two transcripts exist for this gene.
• Uniprot ID: Q9Y5P4
• Protein Accession #: NP_112729
• Nucleotide Accession #: NM_031361
• Protein Size (# AA): 598
• Molecular Weight: 68kDa
• Protein Interactions: ACTL8; ITGB3BP; ARL6IP1; COL4A3BP; CSNK1G2; UBC; NAP1L5; PACSIN2; PNMA2; PPP2R5C; FTL; TGM2; CBS; MARK2; RTN3; POM121; RTN4; COL4A3;