Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
SKU
ARP80695_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

COL3A1 Antibody - N-terminal region (ARP80695_P050)

Rating:
60% of 100
Catalog#: ARP80695_P050
Domestic: within 24 hours delivery International: 3-5 business days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Human
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human COL3A1
Purification Affinity purified
Peptide Sequence Synthetic peptide located within the following region: CDDQELDCPNPEIPFGECCAVCPQPPTAPTRPPNGQGPQGPKGDPGPPGI
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-COL3A1 (ARP80695_P050) antibody is Catalog # AAP80695
Datasheets/Manuals Printable datasheet for anti-COL3A1 (ARP80695_P050) antibody
Gene Symbol COL3A1
Official Gene Full Name collagen type III alpha 1
Alias Symbols EDS4A
NCBI Gene Id 1281
Protein Name collagen alpha-1(III) chain
Description of Target This gene encodes the pro-alpha1 chains of type III collagen, a fibrillar collagen that is found in extensible connective tissues such as skin, lung, uterus, intestine and the vascular system, frequently in association with type I collagen. Mutations in this gene are associated with Ehlers-Danlos syndrome types IV, and with aortic and arterial aneurysms. Two transcripts, resulting from the use of alternate polyadenylation signals, have been identified for this gene.
Swissprot Id P02461
Protein Accession # NP_000081.1
Nucleotide Accession # NM_000090.3
Protein Size (# AA) 1466
Molecular Weight 161 kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express COL3A1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express COL3A1.
Write Your Own Review
You're reviewing:COL3A1 Antibody - N-terminal region (ARP80695_P050)
Your Rating