Search Antibody, Protein, and ELISA Kit Solutions

COL3A1 Antibody - N-terminal region (ARP80695_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Tested Species Reactivity:
Predicted Species Reactivity:
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
collagen type III alpha 1
NCBI Gene Id:
Protein Name:
collagen alpha-1(III) chain
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Description of Target:
This gene encodes the pro-alpha1 chains of type III collagen, a fibrillar collagen that is found in extensible connective tissues such as skin, lung, uterus, intestine and the vascular system, frequently in association with type I collagen. Mutations in this gene are associated with Ehlers-Danlos syndrome types IV, and with aortic and arterial aneurysms. Two transcripts, resulting from the use of alternate polyadenylation signals, have been identified for this gene.
Protein Size (# AA):
Molecular Weight:
161 kDa
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express COL3A1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express COL3A1.
The immunogen is a synthetic peptide directed towards the N terminal region of human COL3A1
Peptide Sequence:
Synthetic peptide located within the following region: CDDQELDCPNPEIPFGECCAVCPQPPTAPTRPPNGQGPQGPKGDPGPPGI
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-COL3A1 (ARP80695_P050) antibody is Catalog # AAP80695
Printable datasheet for anti-COL3A1 (ARP80695_P050) antibody

Product Reviews

Average Rating:
1 review
5 star
4 star
3 star
2 star
1 star
  • Date - Newest First
  • Date - Newest First
  • Date - Latest First
  • Highest Rated
  • Lowest Rated
  • Most Helpful
  • Ownership

1 Item(s)

78/03/2019 03:20
  • Overall Experience:
  • Quality:
Primary human lung fibroblasts in WB

Submitted by:
Thomas Thatcher, Ph.D.
University of Rochester


1. Sample type/lane description: Primary human lung fibroblasts treated with TGFb for 3 days.

2. Primary antibody concentration: 1ug/ml. Overnight 4˚ in 5% NFDM

3. Secondary antibody and dilution: Goat anti-Rabbit. 1:5000 in 5% NFDM for 1 hr at room temp.

4. Protocol:
1. PVDF membrane
2. Blocked in 5% NFDM in TBS-T for 30 minutes

Show more comments (-2) Hide comments

1 Item(s)

What kind of abuse are you reporting?
    Please, wait...