COL27A1 Antibody - middle region (ARP60008_P050)

Catalog No: ARP60008_P050

Host: Rabbit
Target Name: COL27A1
Sample Type: Fetal Lung lysates
Antibody Dilution: 1.0ug/ml

Host: Rabbit
Target: COL27A1
Positive control (+): Human Stomach (ST)
Negative control (-): Human Small Intestine (IN)
Antibody concentration: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Sheep, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human COL27A1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 86%; Horse: 86%; Human: 100%; Mouse: 85%; Pig: 86%; Rabbit: 86%; Rat: 85%; Sheep: 85%; Zebrafish: 85%
• Peptide Sequence: Synthetic peptide located within the following region: LPGPKGDKGSRGDWGLQGPRGPPGPRGRPGPPGPPGGPIQLQQDDLGAAF
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-COL27A1 (ARP60008_P050) antibody is Catalog # AAP60008

Target Info

• Gene Symbol: COL27A1
• Gene Full Name: collagen, type IV, alpha 4
• Alias Symbols: STLS
• NCBI Gene Id: 85301
• Protein Name: Collagen alpha-1(XXVII) chain
• Description of Target: Fibrillar collagens, such as COL27A1, compose one of the most ancient families of extracellular matrix molecules. They form major structural elements in extracellular matrices of cartilage, skin, and tendon.
• Uniprot ID: Q8IZC6-2
• Protein Size (# AA): 827
• Molecular Weight: 90kDa
• Protein Interactions: Dlg4;