Catalog No: OPCA01224
Price: $0.00
SKU
OPCA01224
Availability: Domestic: Antibody & Kits: 2 weeks | Proteins: 4-6 weeks | International: Antibody & Kits: 2 weeks | Proteins: 4-6 weeks
Contact Us:
- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
Shipping Info:
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for COL1A1 Recombinant Protein (Rat) (OPCA01224) |
---|
Predicted Species Reactivity | Rat|Rattus norvegicus |
---|---|
Product Format | Liquid or Lyophilized powder |
Additional Information | Tag information : His tag |
Reconstitution and Storage | -20°C or -80°C |
Purity | Greater than 90% as determined by SDS-PAGE. |
Peptide Sequence | QRGERGFPGLPGPSGEPGKQGPSGASGERGPPGPMGPPGLAGPPGESGREGSPGAEGSPGRDGAPGAKGDRGETGPAGPPGAPGAPGAPGPVGPAGKNGDRGETGPAGPAGPIGPAGARGPAGPQGPRGDKGETGEQGDRGIKGHRGFSGLQGPPGSPGSPGEQGPSGASGPAGPRGPPGSAGSPGKDGLNGLPGPIGPPGPRGRTGDSGPAGPPGPPGPPGPPGPPSGGYDFSFLPQPPQEKSQDGGRYYRA |
Protein Sequence | QRGERGFPGLPGPSGEPGKQGPSGASGERGPPGPMGPPGLAGPPGESGREGSPGAEGSPGRDGAPGAKGDRGETGPAGPPGAPGAPGAPGPVGPAGKNGDRGETGPAGPAGPIGPAGARGPAGPQGPRGDKGETGEQGDRGIKGHRGFSGLQGPPGSPGSPGEQGPSGASGPAGPRGPPGSAGSPGKDGLNGLPGPIGPPGPRGRTGDSGPAGPPGPPGPPGPPGPPSGGYDFSFLPQPPQEKSQDGGRYYRA |
Storage Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Source | Yeast |
Protein Range | 955-1207 aa |
Tag | N-terminal 6xHis-tagged |
Reference | Expression of collagen alpha1(I) mRNA variants during tooth and bone formation in the rat.Brandsten C., Lundmark C., Christersson C., Hammarstroem L., Wurtz T.J. Dent. Res. 78:11-19(1999) |
---|---|
Gene Symbol | Col1a1 |
Gene Full Name | collagen type I alpha 1 chain |
Alias Symbols | alpha-1 type I collagen, COLIA1, collagen alpha-1(I) chain, collagen, type 1, alpha 1, collagen, type I, alpha 1, procollagen type I, alpha 1, procollagen, type 1, alpha 1, type I-alpha 1 collagen. |
NCBI Gene Id | 29393 |
Protein Name | Collagen alpha-1(I) chain |
Description of Target | Type I collagen is a member of group I collagen (fibrillar forming collagen). |
Uniprot ID | P02454 |
Protein Size (# AA) | Partial |
Molecular Weight | 25.4 kda |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
Write Your Own Review